KEGG   Streptococcus pneumoniae 670-6B (serotype 6B): SP670_0469Help
Entry
SP670_0469        CDS       T01308                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
snb  Streptococcus pneumoniae 670-6B (serotype 6B)
Pathway
snb00051  Fructose and mannose metabolism
snb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SP670_0469
Enzymes [BR:snb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     SP670_0469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UPF0052 UDPG_MGDP_dh_N Terminase_2
Motif
Other DBs
NCBI-ProteinID: ADM90542
Position
427260..428396
Genome map
AA seq 378 aa AA seqDB search
MKHSVHFGAGNIGRGFIGEILFKNGFHIDFVDVNNQIIHALNEKGKYEIEIAQKGQSRIE
VTNVAGINSKEHPEQVIEAIQRTDIITTAIGPNILPFIAELLAKGIEARRVAGNTQALDV
MACENMIGGSQFLYQEVKKYLSPEGLTFADNYIGFPNAAVDRIVPAQSHEDSLFVVVEPF
NEWVVETKRLKNPDLRLEDVHYEEDLEPFIERKLFSVNSGHATSAYIGAHYGAKTILEAL
QNPNIKSRIESVLAEIRSLLIAKWNFDKKELENYHKVIIERFENPFIVDEVSRVARTPIR
KLGYNERFIRPIRELKELSLSYKNLLKTVGYAFDYRDVNDEESIRLGELLAKQSVKDVVI
QVTGLDDQELIEQIVEYI
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaaacattctgttcattttggtgccggtaatatcggtcgtggttttataggtgaaatt
ctatttaaaaatggtttccatattgattttgtggatgtcaataatcagataattcatgct
ctaaatgaaaagggcaagtatgaaattgaaattgcacagaaaggacagtctcgtatagaa
gtaactaatgtggctggaattaatagcaaagaacatcctgagcaagtcattgaagcgatt
caaaggacggatattattactactgcaatcggacctaatatactcccttttatcgccgaa
cttctagccaaaggaatcgaagctcgccgagttgcaggaaatacacaggcattggatgtt
atggcctgtgaaaatatgattggcgggtctcaatttctttatcaagaagtcaagaaatat
ttaagtccggaaggtttgacatttgctgataactacataggttttccaaatgctgcagta
gacaggattgttccagcacaaagtcacgaagattccctttttgttgtggtcgagcccttt
aatgaatgggtcgtggaaaccaagcgtcttaaaaatccagatttacgtctagaagatgtg
cattatgaagaagatttagaaccctttattgagcgaaaacttttttcagtcaattctgga
catgcaacttcagcttacattggtgcgcattatggtgccaagacaattttggaagctctt
caaaatcctaatatcaaatctcggattgaatctgtattagctgaaattcggagtctcttg
attgccaaatggaactttgataaaaaagaattggagaattatcacaaagtcattatagaa
cggtttgaaaatcctttcatagtggacgaggttagtcgcgtagctcgtactccaatccga
aaattaggctataatgaacgattcatccggccgatacgtgaattgaaagaactcagtttg
tcatataaaaacctacttaaaacagttggctatgcctttgactatcgcgatgtaaatgat
gaagaaagtattcgattaggtgaattgttggctaaacaatcagtcaaagatgttgttata
caagttacaggtttagacgaccaagaattgattgagcaaattgtagagtatatttaa

DBGET integrated database retrieval system