KEGG   Streptococcus pneumoniae 670-6B (serotype 6B): SP670_0510Help
Entry
SP670_0510        CDS       T01308                                 

Definition
(GenBank) L-iditol 2-dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
snb  Streptococcus pneumoniae 670-6B (serotype 6B)
Pathway
snb00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:snb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SP670_0510
Enzymes [BR:snb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     SP670_0510
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     SP670_0510
    1.1.1.-  
     SP670_0510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ADM90581
Position
complement(461440..462474)
Genome map
AA seq 344 aa AA seqDB search
MKAARWHAAKDVRIQEIEVPEVLPHQVKVAVKFTGICGTDLHEFLDGPIFIPTDEHVYSG
QKAPVTLGHEFSGEIIEVGSDVTRVKVGDRVAVEPILAKNNLVGDYNLDPNLNFVGLAAD
GGFAKYCVLDGDLVHVIPDSLSYEQAALTEPAAVAVYAVRQSSLKAGDTAVVFGLGPIGL
LIVEALRAAGASKIYAVELSPERQAKAEELGAIVVRPEEGETAVEAIHRLTNGGVDVSYE
VTGVPVVLGQALAAVHKAGECMVVSIWEREANINPNEFAIQEKTLKGIIAYRHIFPKVLE
LMEQGYFSAEKLVTKKIKLENIVEEGFIELTQDKSQIKILVEPE
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagctcgctggcatgcagcgaaagatgttcgtattcaagaaatagaagttcct
gaagtacttccgcaccaagtaaaagttgcagttaagttcacaggaatttgtggtactgac
ctccatgaatttttagatggacctatctttatcccaacagatgagcacgtctattctggt
caaaaagcaccggtaacactgggacatgaattttctggtgaaatcatagaagtcggaagc
gatgttacccgtgttaaagttggtgatcgtgttgctgtggaaccaattctagctaaaaat
aacttagttggtgattataatttggatccaaaccttaattttgtcggtttggctgcagac
ggtggatttgccaaatattgtgttttagacggtgacttagtacatgtcattccagatagc
ttgagctatgagcaagctgctcttactgaacccgctgctgttgcagtctatgctgttcgt
caatcttctttgaaggctggcgatacagctgttgtctttggtttaggcccgattggtcta
ttaattgtagaagctcttcgtgcagctggtgcttctaagatttatgctgttgaactatca
cctgaacgtcaagcaaaagctgaagagttaggagctatcgttgtccgtccggaagaaggt
gaaacagctgttgaagctattcatcgtttaacaaacggtggtgtagatgtttcttatgaa
gtaacgggtgtgccagtagttttaggacaagccttagctgccgtacataaagcaggtgag
tgcatggtggtctctatctgggaacgagaagcaaatattaatccgaatgaatttgcaatc
caagaaaagacactaaaaggaatcatcgcttatcgtcatatcttccctaaagtattagaa
ttgatggaacaaggctacttctctgctgaaaaattagttactaagaaaattaaattggaa
aatatcgtcgaagaaggctttatcgaattaactcaagataagtcacaaattaaaattttg
gtagaaccagaataa

DBGET integrated database retrieval system