KEGG   Streptococcus pneumoniae 670-6B (serotype 6B): SP670_1284Help
Entry
SP670_1284        CDS       T01308                                 

Definition
(GenBank) site-specific recombinase/resolvase
  KO
K06400  site-specific DNA recombinase
Organism
snb  Streptococcus pneumoniae 670-6B (serotype 6B)
Brite
KEGG Orthology (KO) [BR:snb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    SP670_1284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Resolvase Recombinase Zn_ribbon_recom CENP-F_leu_zip APG6 Cnn_1N Catalase-rel
Motif
Other DBs
NCBI-ProteinID: ADM91345
Structure
PDB: 

Position
complement(1207642..1209228)
Genome map
AA seq 528 aa AA seqDB search
MKAFAIYNDYEIVGEYEDAGKSGKSIEGRIQFNRMMEDIKSGKDGVSFVLVFKLSRFARN
AADVLSTLQIMQDYGVNLICVEDGIDSSKDAGKLMISVLSAVAEIERENIRIQTMEGRIQ
KAREGKWNGGFAPYGYKLEDGKLFINEEEAVAIRTIFDQYVNTTIGANGISKYLENHGIR
KIPRQNGKNPLFDAGLIRKILKNPVYNGKIAFGRRTLEKVHGTRNEYKQVEQDEYLISEG
IHEAIVSDEVWQAAQVKLKSQAKKYEHVNKGKDTRTHLLSGIVKCPICGVGMFGNKCIKK
KKDGTKYKDFYYYGCKHRQMIRGHKCTFSKQIREELLDDAVAEVIVKIVSNPKFASMMQE
KINMKVDTSEIEKEIDNYQKELRKSHSTKFKLIEEIDNLDVEDKHYKRRKQDLDDRLYRM
YDKIDELESSLIDAKAKKQTIEAEKLTGDNIYKVLIYFDKLYKVMNDVERRQLISALISE
IQVYEEKQSNGQWLKSITFKLPIIEENLNIGLDNDEQVECVSLLEKRS
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcttttgctatttacaacgattatgaaattgttggagagtatgaagatgccggg
aagtctggcaagtctattgaaggtagaatacagttcaatcgaatgatggaagatataaaa
tctggaaaagatggagtatcttttgttcttgtgtttaagttatcaagatttgcaagaaat
gccgctgatgttctttctacacttcagataatgcaggattatggagttaatcttatctgc
gttgaagatggcattgattcatctaaagatgctgggaaactaatgatttctgttttatca
gctgtggctgaaatagaaagagaaaacatccgtattcaaacaatggaaggtcgcattcaa
aaagcaagggaaggaaaatggaatggtggctttgctccgtatggatataaacttgaagac
ggcaagctgtttataaatgaggaagaggcagttgcaataagaacgattttcgaccagtat
gtaaatactacgataggagccaatgggatatctaaatacttagagaatcatggaattaga
aaaatcccaagacagaatggtaagaatcctttgtttgatgcaggtcttataagaaagata
ttaaagaatcctgtatataatgggaaaatagcatttggaagaagaactttagaaaaagtt
catggtacaagaaatgaatataagcaggttgaacaagatgaatatctaatatctgaaggg
atacatgaagctatagtttccgatgaagtttggcaagctgctcaggttaagctaaaatct
caagcaaagaaatatgagcatgtgaataaaggaaaagatacacgcacacacttgctttct
ggaattgtaaaatgcccgatatgtggagtgggaatgtttgggaacaagtgtatcaagaaa
aagaaagatggcacaaagtataaagatttttattactatggttgtaaacataggcagatg
ataagaggtcataagtgtacattcagtaagcaaattagagaagaattgttagatgatgct
gttgcagaggtgattgtcaagatagtaagtaatccgaaatttgcttctatgatgcaagaa
aaaatcaacatgaaggtggatacctctgaaatagaaaaagaaatagataattaccaaaag
gaattgagaaagagtcattctacaaagtttaagctaattgaggaaatagataatttagat
gttgaagataagcattataagagaaggaaacaggatttagatgatagactatatcgtatg
tatgacaaaatagatgaattagaatcatcactaattgatgcgaaagcaaagaaacagact
attgaagctgaaaagcttacaggagataacatatataaggttctaatctattttgataag
ctctataaagtcatgaatgatgtagagcgtaggcagttaatttcagctttgatttctgaa
attcaagtttatgaagaaaaacaatctaacggacaatggctaaaatccattacttttaag
ctaccaattatagaagaaaatctcaacataggtttggacaatgatgaacaagttgaatgt
gtaagtttattagagaaacgtagttaa

DBGET integrated database retrieval system