KEGG   Streptococcus pneumoniae 670-6B (serotype 6B): SP670_1298Help
Entry
SP670_1298        CDS       T01308                                 

Definition
(GenBank) acetyltransferase, gnat family protein
Organism
snb  Streptococcus pneumoniae 670-6B (serotype 6B)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_10 Acetyltransf_1 Acetyltransf_7 Acetyltransf_4 Acetyltransf_9 FR47 Acetyltransf_CG
Motif
Other DBs
NCBI-ProteinID: ADM91359
Position
complement(1222141..1222572)
Genome map
AA seq 143 aa AA seqDB search
MLRDLQETDVKAICDINQETLGYTFSPEETASQLARLSQDSHHFLLGYEDAANHVLLGYV
HAEVYESLYSKAGFNILALAVSPQAQGQGIGKSLLQGLEQEAKRCGYGFIRLNSANHRLG
AHAFYEKVGYTCDKMQKRFIRIF
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgctaagagatttgcaagaaacagatgtgaaagcgatatgtgacatcaaccaagagact
ttgggttatacttttagtccagaggaaacggctagccaactagctagactgtctcaggat
tcccatcatttcctacttggctatgaggatgcagctaatcatgtcttacttggatatgtc
cacgctgaagtttacgaatcactctattccaaagcaggatttaatatcttagctttagca
gtttcacctcaagcgcaaggtcaaggtatcggtaaaagtttactacaagggttggaacaa
gaagccaaaagatgtggttatgggtttatccgcttaaattctgccaatcatcgtctgggt
gctcatgcattttatgaaaaagttggctatacttgtgataaaatgcagaaacggtttatt
cgcatcttttag

DBGET integrated database retrieval system