KEGG   Streptococcus pneumoniae 670-6B (serotype 6B): SP670_1300Help
Entry
SP670_1300        CDS       T01308                                 

Gene name
hemK
Definition
(GenBank) protein-(glutamine-N5) methyltransferase, release factor-specific
  KO
K02493  release factor glutamine methyltransferase [EC:2.1.1.297]
Organism
snb  Streptococcus pneumoniae 670-6B (serotype 6B)
Brite
KEGG Orthology (KO) [BR:snb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:snb03012]
    SP670_1300 (hemK)
Enzymes [BR:snb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.297  peptide chain release factor N5-glutamine methyltransferase
     SP670_1300 (hemK)
Translation factors [BR:snb03012]
 Eukaryotic Type
  Release factors
   SP670_1300 (hemK)
 Prokaryotic Type
   SP670_1300 (hemK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS Methyltransf_31 Methyltransf_25 Methyltransf_23 PrmA Methyltransf_12 Methyltransf_18 Methyltransf_11 Methyltransf_10 Methyltransf_4 UPF0020 Methyltransf_16 TehB PCMT Cons_hypoth95 TrmK Eco57I CMAS Ubie_methyltran Methyltransf_32 GidB Methyltransf_2 NodS DUF938 RrnaAD Sigma70_ECF
Motif
Other DBs
NCBI-ProteinID: ADM91361
Position
complement(1223160..1223999)
Genome map
AA seq 279 aa AA seqDB search
MKLAQLFSNFEEELIRQGEEAESLSFVYRSLKNLSFTDFIFALQQEVTTEEEKQFVEDIY
QQLAAHKPAQYIIGQADFYGMHLKVDERVLIPRPETEELVELILTENLETNLSVLDIGTG
SGAIALALAKNRPDWSVTAADVSQEALELASENASDQNLNIFFKKSDCFAEISEKYDIIV
SNPPYISREDESEVGLNVLHSEPHLALFADEDGLAIYCRIAEDAKDYLKDGGKIYLEIGY
KQGQSVPELFRKHLPEKKVRTLKDQFGQDRMVVVDDGQD
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagctcaattattttcaaattttgaagaagagttgataagacaaggagaggaa
gcggaaagcctctcttttgtctatcgtagtctgaaaaatctatcttttacagactttatt
tttgccctccagcaggaggtgacaacagaggaagaaaaacaatttgtagaagatatttac
cagcaactagcagctcacaagccagctcagtacatcattggacaggcagatttttatgga
atgcatttaaaggtggatgaacgggttttgattcctcgtccagaaacagaggagttagtg
gagcttattctaactgaaaatcttgagacgaatctctcagttctggatattggaacaggt
agtggagctattgctctcgctctagcaaaaaatagaccagattggtcagtgacagcagca
gatgtttctcaagaggccttagagcttgcatcagagaatgctagcgatcaaaatcttaat
atattttttaaaaaatctgattgttttgcagaaatttctgaaaaatatgatataattgta
tccaatccaccctatatctctcgtgaagatgagtcagaggtaggcttgaatgttttgcat
tcggagcctcatctagctctctttgcagacgaggatggcctagctatttactgtagaatt
gcggaagatgcaaaagactatctcaaggatggtggtaagatttaccttgaaattggatac
aagcaaggtcaaagtgttcccgaactttttagaaaacatcttcctgaaaaaaaagttcga
acactcaaagaccaatttggtcaagataggatggtcgtggttgatgatggacaggattag

DBGET integrated database retrieval system