KEGG   Streptococcus pneumoniae 670-6B (serotype 6B): SP670_1301Help
Entry
SP670_1301        CDS       T01308                                 

Gene name
prfA
Definition
(GenBank) peptide chain release factor 1
  KO
K02835  peptide chain release factor 1
Organism
snb  Streptococcus pneumoniae 670-6B (serotype 6B)
Brite
KEGG Orthology (KO) [BR:snb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:snb03012]
    SP670_1301 (prfA)
Translation factors [BR:snb03012]
 Eukaryotic Type
  Release factors
   SP670_1301 (prfA)
 Prokaryotic Type
   SP670_1301 (prfA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCRF RF-1 ABC_tran_CTD
Motif
Other DBs
NCBI-ProteinID: ADM91362
Position
complement(1223999..1225078)
Genome map
AA seq 359 aa AA seqDB search
MNIYDQLQAVEDRYEELGELLSDPDVVSDTKRFMELSKEEASNRDTVIAYREYKQVLQNI
VDAEEMIKESGGDADLEEMAKQELKDAKAEKEEYEEKLKILLLPKDPNDDKNIILEIRGA
AGGDEAALFAGDLLTMYQKYAEAQGWRFEVMEASMNGVGGFKEVVAMVSGQSVYSKLKYE
SGAHRVQRVPVTESQGRVHTSTATVLVMPEVEEVEYDIDPKDLRVDIYHASGAGGQNVNK
VATAVRIVHLPTNIKVEMQEERTQQKNREKAMKIIRARVADHFAQIAQDEQDAERKSTIG
TGDRSERIRTYNFPQNRVTDHRIGLTLQKLDTILSGKLDEVVDALVLYDQTQKLEELNK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaacatctatgatcaactacaagctgtagaagaccgttatgaagaactaggagaattg
ctgagtgaccctgatgtcgtttcagacaccaagcgttttatggagctttcaaaagaagaa
gcttccaatcgtgacaccgtaatagcctaccgtgagtataaacaagtccttcaaaatatc
gtcgatgccgaagagatgattaaggaatcaggcggagatgcggacttggaagaaatggcc
aagcaagaactcaaagatgccaaggctgaaaaagaagaatatgaagaaaaactgaaaatt
ttgctccttccaaaggatccaaacgatgacaagaatatcatccttgaaatccgtggagca
gctggtggagacgaagcggcacttttcgctggagatttgctaactatgtaccaaaagtat
gcggaagcccaaggttggcgctttgaagtcatggaagcctctatgaatggtgtcggtggt
tttaaagaagtggttgctatggtttcaggtcagtctgtatactctaagcttaagtatgaa
tcaggtgcccaccgtgtgcaacgtgttcctgtgacagaaagccaaggccgtgttcatact
tcgacagcgacagttcttgttatgccagaagttgaagaggttgaatacgacattgatcca
aaagaccttcgtgtcgacatctatcacgcctctggtgctggtggacagaacgtcaataag
gttgcgactgccgttcgtatcgttcacttgccaaccaatatcaaggttgagatgcaggaa
gaacgtacccagcagaagaaccgcgagaaggctatgaagattatccgtgcacgcgtcgct
gaccactttgctcagattgctcaggatgaacaagacgctgagcgtaagtcgacaatcggt
actggtgaccgttcagaacggatccgaacttataacttcccacaaaaccgtgtcacagac
caccgtatcggcttgaccctccaaaaactagatacgattttgtctggtaaattggacgaa
gttgtggatgccttggtgctttatgaccaaacacaaaaactagaagaattaaacaaataa

DBGET integrated database retrieval system