KEGG   Streptococcus pneumoniae 670-6B (serotype 6B): SP670_1306Help
Entry
SP670_1306        CDS       T01308                                 

Gene name
asd
Definition
(GenBank) aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Organism
snb  Streptococcus pneumoniae 670-6B (serotype 6B)
Pathway
snb00260  Glycine, serine and threonine metabolism
snb00261  Monobactam biosynthesis
snb00270  Cysteine and methionine metabolism
snb00300  Lysine biosynthesis
snb01100  Metabolic pathways
snb01110  Biosynthesis of secondary metabolites
snb01120  Microbial metabolism in diverse environments
snb01130  Biosynthesis of antibiotics
snb01210  2-Oxocarboxylic acid metabolism
snb01230  Biosynthesis of amino acids
Module
snb_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:snb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SP670_1306 (asd)
   00270 Cysteine and methionine metabolism
    SP670_1306 (asd)
   00300 Lysine biosynthesis
    SP670_1306 (asd)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    SP670_1306 (asd)
Enzymes [BR:snb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.11  aspartate-semialdehyde dehydrogenase
     SP670_1306 (asd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dhC Semialdhyde_dh DapB_N Gp_dh_C NAD_binding_10 Epimerase Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: ADM91367
Structure
PDB: 

Position
complement(1228517..1229593)
Genome map
AA seq 358 aa AA seqDB search
MGYTVAVVGATGAVGAQMIKMLEESTLSIDKIRYLASARSAGKSLKFKDQDITIEETTET
AFEGVDIALFSAGSSTSAKYAPYAVKAGVVVVDNTSYFRQNPDVPLVVPEVNAHALDAHN
GIIACPNCSTIQMMVALEPVRQKWGLDRIIVSTYQAVSGAGMGAILETQRELREVLNDGV
KPCDLHAEILPSGGDKKHYPIAFNALPQIDVFTDNDYTYEEMKMTKETKKIMEDDSIAVS
ATCVRIPVLSAHSESVYIETKEVAPIEEVKAAIAAFPGAVLEDDVAHQIYPQAINAVGSR
DTFVGRIRKDLDAEKGIHMWVVSDNLLKGAAWNSVQIAETLHERGLVRPTAELKFELK
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgggatatacagttgctgtagtcggcgcgacaggtgctgtcggtgctcagatgataaaa
atgttggaagaatcaacactttcaatcgataaaatccgttaccttgcttctgcacgttca
gcaggtaagtcattgaaatttaaagatcaagatattacaattgaagaaacgactgaaaca
gcttttgaaggagttgatattgctctcttttcagcaggtagttctacatcagctaagtat
gcaccatacgcagtaaaagctggcgtggtagtagtagataatacatcttatttccgtcaa
aatccagatgttcctttggttgttccagaggtcaatgctcatgcacttgatgctcacaac
ggaatcattgcctgccctaattgttcaacaatccaaatgatggtggctcttgagccggtt
cgccaaaaatggggcttggaccgtatcattgtttcaacttatcaagccgtttcaggtgct
ggtatgggagcaattcttgagacacaacgtgaacttcgtgaagtcttgaatgatggtgtg
aaaccatgtgatttgcatgcggaaattttgccttcaggtggtgacaagaaacattatcct
atcgcctttaacgctcttccacaaattgatgttttcactgataatgattacacgtacgaa
gagatgaagatgaccaaggaaactaagaaaattatggaagatgatagcattgcagtatct
gcaacatgtgtgcgtattccagtcttgtcagctcactctgagtctgtttatatcgaaaca
aaagaagtggctccaatcgaagaagtaaaagcagctatcgcagccttcccaggtgctgtt
cttgaagatgatgtagctcatcaaatctatcctcaagctatcaatgcagttggttcgcgt
gatacctttgttggtcgtatccgtaaagacttggatgcagaaaaaggaattcacatgtgg
gttgtttcagataaccttctcaaaggtgctgcttggaactcagttcagattgctgaaact
cttcatgaacgtggattggttcgtccaacagctgaattgaaatttgaattaaaatag

DBGET integrated database retrieval system