KEGG   Streptococcus pneumoniae 670-6B (serotype 6B): SP670_1319Help
Entry
SP670_1319        CDS       T01308                                 

Definition
(GenBank) zinc-binding lipoprotein AdcA
  KO
K09815  zinc transport system substrate-binding protein
Organism
snb  Streptococcus pneumoniae 670-6B (serotype 6B)
Pathway
snb02010  ABC transporters
Module
snb_M00242  Zinc transport system
Brite
KEGG Orthology (KO) [BR:snb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SP670_1319
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:snb02000]
    SP670_1319
Transporters [BR:snb02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Zinc transporter [MD:M00242] [OT]
    SP670_1319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ZnuA SpoIIP
Motif
Other DBs
NCBI-ProteinID: ADM91380
Structure
PDB: 

Position
complement(1242674..1243591)
Genome map
AA seq 305 aa AA seqDB search
MKKQNLFLVLLSVFLLCLGACGQKESQTGKGMKIVTSFYPIYAMVKEVSGDLNDVRMIQS
SSGIHSFEPSANDIAAIYDADVFVYHSHTLESWAGSLDPNLKKSKVKVLEASEGMTLERV
PGLEDVEAGDGVDEKTLYDPHTWLDPEKAGEEAQIIADKLSEVDSEHKETYQKNAQAFIK
KAQELTKKFQPKFEKATQKTFVTQHTAFSYLAKRFGLNQLGIAGISPEQEPSPRQLTEIQ
EFVKTYKVKTIFTESNASSKVAETLVKSTGVGLKTLNPLESDPQNDKTYLENLEENMSIL
AEELK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacaaaatttatttttagtcctgttaagtgtctttcttttgtgcttgggggct
tgtggtcaaaaggaaagtcagacaggaaaggggatgaaaattgtgaccagtttttatcct
atctacgctatggttaaggaagtatctggtgacttgaatgatgttcggatgattcagtca
agtagtggtattcactcctttgaaccttcggcaaatgatatcgcagccatctatgatgca
gatgtctttgtttaccattctcatacactcgaatcttgggcaggaagtctggatccaaat
ctaaaaaaatccaaagtgaaggtcttagaggcttctgagggaatgaccttggaacgtgtc
cctggactagaggatgtggaagcaggggatggagttgatgaaaaaacgctctatgaccct
cacacatggctagatcctgaaaaagctggagaagaagcccaaattatcgctgataaactt
tcagaggtggatagtgagcataaagagacttatcaaaaaaatgcgcaagcctttatcaaa
aaagctcaggaattgactaagaaattccaaccaaaatttgaaaaagcgactcagaaaaca
tttgtaacacaacatacagccttttcttatctagcgaagagatttgggcttaatcaactt
ggtattgcaggtatctctcctgaacaagaaccaagtccacgacaactaacagaaattcag
gaatttgttaagacctataaggttaaaacgatttttacagaaagtaacgcttcttcaaaa
gtagctgaaactcttgtcaaatcaacaggtgtaggtcttaaaactctgaatcctttagag
tcagacccacaaaatgacaagacctatttagaaaatcttgaagaaaatatgagtattcta
gcagaagaattaaagtga

DBGET integrated database retrieval system