KEGG   Streptococcus pneumoniae 670-6B (serotype 6B): SP670_1330Help
Entry
SP670_1330        CDS       T01308                                 

Definition
(GenBank) conserved hypothetical protein
Organism
snb  Streptococcus pneumoniae 670-6B (serotype 6B)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADM91391
Position
complement(1252412..1252726)
Genome map
AA seq 104 aa AA seqDB search
MGKSLLTDEMIERANRGEKISGPPLLDDNEETKILPTSSSRFGYANPKDHGFSQETLKIQ
VEPSIHKSRRIENTKRNVFNSKLNKILFAVIFLLILLVLAMKLL
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaatctttattaacggatgaaatgattgaaagagctaatagaggcgaaaaaatt
tcaggtcctcctttgctagatgataatgaggaaactaagattttaccaacctcttcttcc
cgttttggttatgccaatcctaaggatcatggttttagccaggaaaccttgaagattcag
gtcgaaccatctattcataaaagccgtcgtattgaaaataccaagagaaatgtcttcaat
tctaagttgaataaaatcttatttgcggtcatctttctcttgattttgcttgttttagca
atgaaacttttgtaa

DBGET integrated database retrieval system