KEGG   Streptococcus pneumoniae 670-6B (serotype 6B): SP670_1340Help
Entry
SP670_1340        CDS       T01308                                 

Definition
(GenBank) O-methyltransferase family protein
Organism
snb  Streptococcus pneumoniae 670-6B (serotype 6B)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_3 Methyltransf_24 Methyltransf_31 Methyltransf_25 Methyltransf_11 MTS Met_10 Methyltransf_23 Methyltransf_12 PCMT Spermine_synth CmcI Methyltransf_4 Methyltransf_16 Cons_hypoth95 Methyltransf_15 Methyltransf_18 ADH_zinc_N GidB Methyltransf_5 NAS
Motif
Other DBs
NCBI-ProteinID: ADM91401
Position
complement(1259874..1260551)
Genome map
AA seq 225 aa AA seqDB search
MRRPVVKEEIVDLMRQRQKQVTGFLKELEDFARKENIPIIPHETVAYFRFLMETMQPKNI
LEIGTAIGFSALLMAEHAPNAKITTIDRNPEMIGFAKENFAQFDSRKQITLLEGDAVDVL
STLTESYDFVFMDSAKSKYIVFLPEILKHLEVGGVVVLDDIFQGGDVAKDIMEVRRGQRT
IYRGLQKLFDATLDNPELTATLVPLGDGILMLRKNVADVQLSESE
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgtcctgtcgtcaaagaagaaattgtagacttgatgcgtcagcgtcaaaagcag
gtcacaggtttcttgaaagaattggaagactttgcccgcaaggaaaatattcctattatt
ccccatgaaacggttgcttatttccgttttcttatggaaaccatgcagcctaaaaatatt
ctggaaattgggacggctatcggtttttcagctctcttgatggctgaacatgcgccaaat
gctaagattacaactattgatcgtaatccagaaatgattggttttgccaaggaaaatttt
gcccagtttgacagtcgcaagcaaatcactctcctagagggagatgcggtggatgtctta
tctacactgacagagtcttatgatttcgtctttatggattctgccaagtctaaatacatc
gtctttctgccagaaatcctcaaacatttggaagttggtggtgtggttgtcttggatgat
atttttcaaggtggtgatgttgccaaggatattatggaagtccgtcgtggtcagcgaacc
atttatcgaggccttcaaaaattatttgatgcaaccttagacaatccagaactcaccgca
acattagtgcctttaggagatggtattctcatgcttcgtaaaaatgtagcagatgttcaa
ctgtctgaaagcgaatga

DBGET integrated database retrieval system