KEGG   Streptococcus pneumoniae 670-6B (serotype 6B): SP670_1348Help
Entry
SP670_1348        CDS       T01308                                 

Gene name
coaE
Definition
(GenBank) dephospho-CoA kinase
  KO
K00859  dephospho-CoA kinase [EC:2.7.1.24]
Organism
snb  Streptococcus pneumoniae 670-6B (serotype 6B)
Pathway
snb00770  Pantothenate and CoA biosynthesis
snb01100  Metabolic pathways
Module
snb_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:snb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SP670_1348 (coaE)
Enzymes [BR:snb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.24  dephospho-CoA kinase
     SP670_1348 (coaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoaE AAA_28 dNK AAA_18 AAA_33 Bestrophin AAA_17
Motif
Other DBs
NCBI-ProteinID: ADM91409
Position
complement(1268806..1269411)
Genome map
AA seq 201 aa AA seqDB search
MRKIIGITGGIASGKSTVTNFLRQQGFQVVDADAVVHQLQKPGGRLFEALVQHFGQEIIL
ENGELNRPLLASLIFSNPEEQKWSKQIQGEIIREELATLREQLAQTEEIFFMDIPLLFEQ
DYSDWFAETWLVYVDRDTQVERLMKRDQLSKDEAEFRLAAQWPLEKKKDLASQVLDNNGN
QNQLLNQVHILLEGGRQDDRD
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaatcatcggaatcactgggggaattgcctctggtaagtcaactgtgacaaat
tttctaagacagcaaggctttcaagtagtggatgccgacgcagtcgtccaccaactacag
aaacctggtggtcgtctgtttgaggctctagtacagcactttgggcaagaaatcattctt
gaaaacggagaactcaatcgccctctcctagctagtctcatcttttcaaatcctgaagag
caaaaatggtctaagcaaattcaaggggagattatccgtgaggaactggctactttgaga
gaacagttggctcagacagaagagattttcttcatggatattcccctactttttgagcag
gactacagcgattggtttgctgagacttggttggtctatgtggaccgagatacccaagta
gaacgcttaatgaaaagggaccagttgtccaaagatgaagctgagtttcgtctggcagcc
cagtggcctttagaaaaaaagaaagatttggccagccaggttcttgataataatggcaat
cagaaccagcttcttaatcaagtgcatatccttcttgagggaggtaggcaagatgacaga
gattaa

DBGET integrated database retrieval system