KEGG   Streptococcus pneumoniae 670-6B (serotype 6B): SP670_1358Help
Entry
SP670_1358        CDS       T01308                                 

Gene name
rplT
Definition
(GenBank) ribosomal protein L20
  KO
K02887  large subunit ribosomal protein L20
Organism
snb  Streptococcus pneumoniae 670-6B (serotype 6B)
Pathway
snb03010  Ribosome
Module
snb_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:snb00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SP670_1358 (rplT)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:snb03011]
    SP670_1358 (rplT)
Ribosome [BR:snb03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    SP670_1358 (rplT)
  Bacteria
    SP670_1358 (rplT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L20
Motif
Other DBs
NCBI-ProteinID: ADM91419
Position
complement(1278538..1278897)
Genome map
AA seq 119 aa AA seqDB search
MARVKGGVVSRKRRKRILKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL
WITRINAAARMNGLSYSQLMHGLKLAEIEVNRKMLADLAVNDAVAFTALADAAKAKLGK
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtgttaaaggtggcgttgtatcacgcaaacgtcgtaaacgtattcttaaatta
gcaaaaggttactatggagctaaacacatcttattccgtactgcaaaagaacaagtaatg
aactcttactactatgcataccgtgaccgtcgtcagaaaaaacgtgacttccgcaaattg
tggattactcgtatcaatgcggcagctcgtatgaacggactttcatactcacaattgatg
catggtttgaaattggctgagattgaagttaaccgtaaaatgcttgctgacttggctgtt
aacgatgcagtagctttcacagctcttgcagatgcagctaaagcaaaacttggtaaataa

DBGET integrated database retrieval system