KEGG   Streptococcus pneumoniae 670-6B (serotype 6B): SP670_1359Help
Entry
SP670_1359        CDS       T01308                                 

Gene name
rpmI
Definition
(GenBank) ribosomal protein L35
  KO
K02916  large subunit ribosomal protein L35
Organism
snb  Streptococcus pneumoniae 670-6B (serotype 6B)
Pathway
snb03010  Ribosome
Module
snb_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:snb00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SP670_1359 (rpmI)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:snb03011]
    SP670_1359 (rpmI)
Ribosome [BR:snb03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    SP670_1359 (rpmI)
  Bacteria
    SP670_1359 (rpmI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L35p
Motif
Other DBs
NCBI-ProteinID: ADM91420
Position
complement(1278949..1279149)
Genome map
AA seq 66 aa AA seqDB search
MPKQKTHRASAKRFKRTGSGGLKRFRAYTSHRFHGKTKKQRRHLRKASMVHSGDYKRIKA
MLTRLK
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaacaaaaaacacaccgcgcatcagctaaacgtttcaaacgtacaggttctggt
ggacttaaacgtttccgtgcttacacttctcaccgtttccacggaaaaactaagaaacaa
cgtcgtcatcttcgtaaagcatctatggtgcattcaggagattacaaacgtatcaaagca
atgcttactcgcttgaaataa

DBGET integrated database retrieval system