KEGG   Streptococcus pneumoniae 670-6B (serotype 6B): SP670_1373Help
Entry
SP670_1373        CDS       T01308                                 

Definition
(GenBank) PhoH family protein
  KO
K06217  phosphate starvation-inducible protein PhoH and related proteins
Organism
snb  Streptococcus pneumoniae 670-6B (serotype 6B)
Brite
KEGG Orthology (KO) [BR:snb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    SP670_1373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoH AAA_30 AAA_19 IstB_IS21 AAA_22 AAA_25 UvrD-helicase
Motif
Other DBs
NCBI-ProteinID: ADM91431
Position
complement(1288319..1289287)
Genome map
AA seq 322 aa AA seqDB search
MKEHSIDIQLSHPDDLFHLFGSNERHLRLMEEELDVVIHARTEIVQVLGEESACEEARQV
IQALMALVNRGMTVGTPDVVTAISMVKNDEIDKFVALYEEEIIKDNTGKPIRVKTLGQKL
YVDSVKQHDVTFGIGPAGTGKTFLAVTLAVTALKRGQVKRIILTRPAVEAGESLGFLPGD
LKEKVDPYLRPVYDALYQILGKDQTTRLMEREIIEIAPLAYMRGRTLDDAFVILDEAQNT
TIMQMKMFLTRLGFHSKMIVNGDISQIDLPRNVKSGLIDAQEKLKNIHQIDFVHFSAKDV
VRHPVVAQIIRAYEYSTEVAHD
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggaacattcaatagacattcaactgagtcatccagatgacctgtttcatcttttt
ggttccaatgaacgccatcttcgtttgatggaagaagagcttgatgttgtgattcatgct
cgtacggagattgtccaggttttgggagaagagtctgcttgcgaggaagcccgtcaggtt
attcaagctctcatggccttggtaaatcgtgggatgaccgttggtacgccagatgtagtg
acggctattagtatggtcaaaaatgatgaaattgacaagtttgtcgccctttacgaagaa
gaaatcatcaaggataatactgggaagcctatccgcgtcaaaaccttaggtcaaaaactt
tatgtggacagtgtcaaacagcatgatgtgacctttggaattgggccggcaggtacaggg
aagaccttccttgcagtgaccttggcagtgactgcccttaaacgtgggcaagtcaagcga
attatcctaactcgtccagcggtggaagcgggagagagtcttggatttcttccgggtgat
cttaaggagaaggtggatccttaccttcgtcctgtttacgatgccttgtatcaaattctt
gggaaagaccaaacgactcgtctcatggagcgtgaaattatcgaaattgcgccccttgcc
tatatgcgtggccggaccttggatgatgcctttgtcattctcgatgaggcgcaaaacacg
accatcatgcagatgaagatgttcttgacgcgtttaggctttcattctaagatgattgtc
aatggagatatcagtcagattgacctgccacgtaatgtcaagtccggtttgattgatgct
caagagaaactcaagaacatccatcagattgactttgttcatttttcagctaaggatgtg
gttcgccatccagttgtcgctcaaattatccgagcctatgaatattctactgaagttgca
cacgactga

DBGET integrated database retrieval system