KEGG   Streptococcus pneumoniae 670-6B (serotype 6B): SP670_1381Help
Entry
SP670_1381        CDS       T01308                                 

Definition
(GenBank) phage protein
Organism
snb  Streptococcus pneumoniae 670-6B (serotype 6B)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RepA_N HTH_36
Motif
Other DBs
NCBI-ProteinID: ADM91439
Position
complement(1294519..1295166)
Genome map
AA seq 215 aa AA seqDB search
MDFEYFYNREAERFNFLKVPEILVDREEFRGLSAEAIILYSILLKQTGMSFKNNWIDKEG
RVFIYFTVEEIMKRRNISKPTAIKTLDELDVKKGIGLIERVRLGLGKPNIIYVKDFMSIF
QVKENDLQKSKNLTSEVKDFNLRSKENELQEVKNLDSNYIENNKSKYSKREYSFGENGLG
TFQNVFLAAEDISDLQIIMNSQLENYIRLPAKLES
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggactttgaatatttttataacagagaagcggaaagatttaacttcttaaaagtaccg
gagatattagttgatagagaagaatttcggggcttatcagcagaagcaattatcctttat
tccatacttcttaaacagacaggaatgtcatttaagaataactggatagacaaggaaggc
agagtatttatctattttactgtcgaagaaattatgaaaagaagaaatatctcaaagcca
actgccataaaaacattagatgagcttgatgtaaaaaaaggaataggactgatcgaaaga
gtaaggcttggacttggtaagccgaacatcatttatgttaaagactttatgagtatattt
caggtaaaagaaaatgacttacagaagtcaaaaaacttaacttcagaagtaaaagatttt
aacctcagaagtaaagaaaatgaacttcaagaggttaagaaccttgactctaactatata
gagaataataagagtaagtatagtaagagagaatatagttttggtgaaaacggacttgga
acatttcaaaatgtgtttttagctgctgaagatatatcggatttacaaatcataatgaac
tcacagcttgagaattacattagacttcctgcaaaactagaatcctag

DBGET integrated database retrieval system