KEGG   Streptococcus pneumoniae 670-6B (serotype 6B): SP670_1384Help
Entry
SP670_1384        CDS       T01308                                 

Definition
(GenBank) initiation-control protein YabA
Organism
snb  Streptococcus pneumoniae 670-6B (serotype 6B)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YabB HAP1_N DegS TSC22 NYD-SP28_assoc JAKMIP_CC3 NEMO HMMR_C CENP-H NRBF2
Motif
Other DBs
NCBI-ProteinID: ADM91442
Position
complement(1296892..1297209)
Genome map
AA seq 105 aa AA seqDB search
MDKKELFDALDDFSQQLLVTLADVEAIKKNLKSLVEENTALRLENSKLRERLGEVEADAP
VKAKHVRESVRRIYRDGFHVCNDFYGQRREQDEECMFCDELLYRE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaaaagaattatttgacgcgctggatgatttttcccaacaattattggtaacc
ttagccgatgtggaagccatcaagaaaaatctcaagagcttggtagaagaaaatacagct
cttcgcttggaaaatagtaagttgcgagaacgcttgggtgaggtggaagcagacgctccc
gtcaaggccaagcatgttcgcgaaagtgtccgtcgcatttaccgtgatggatttcacgta
tgtaatgatttttatggacaacgtcgagagcaggacgaagaatgtatgttctgtgatgag
ttgttatacagggagtaa

DBGET integrated database retrieval system