KEGG   Streptococcus pneumoniae 670-6B (serotype 6B): SP670_1398Help
Entry
SP670_1398        CDS       T01308                                 

Gene name
aguA
Definition
(GenBank) agmatine deiminase
  KO
K10536  agmatine deiminase [EC:3.5.3.12]
Organism
snb  Streptococcus pneumoniae 670-6B (serotype 6B)
Pathway
snb00330  Arginine and proline metabolism
snb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    SP670_1398 (aguA)
Enzymes [BR:snb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.12  agmatine deiminase
     SP670_1398 (aguA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAD_porph
Motif
Other DBs
NCBI-ProteinID: ADM91456
Position
complement(1309732..1310817)
Genome map
AA seq 361 aa AA seqDB search
MMDSPKKLGYHMPAEYEPHHGTLMIWPTRPGSWPFQGKAAKRAFTQIIETIAEGERVYLL
VEQAYLSEAQSYLGDKVVYLDIPTNDAWARDTGPTILVNDKGKKLAVDWAFNAWGGTYDG
LYQDYEEDDQVASRFAEALERPVYDAKPFVLEGGAIHSDGQGTILVTESCLLSPGRNPNL
TKEEIENTLLESLGAEKVIWLPYGIYQDETNEHVDNVAAFVGPAEVVLAWTDDENDPQYA
MSKADLELLEQETDAKGCHFTIHKLPIPAVRQVVTEEDLPGYIYEEGEEERYAGERLAAS
YVNFYIANKAVLVPQFEDVNDQVALDILSKCFPDRKVVGIPARDILLGGGNIHCITQQIP
E
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgatggacagtccaaaaaaattaggctatcacatgccagcagagtacgaaccccatcat
ggtaccctcatgatatggccgactcgaccaggatcatggccttttcaaggaaaggctgct
aaaagagcatttactcagatcatcgagaccatagcagaaggggaaagagtctatcttttg
gtggagcaggcctatctatctgaagcccaatcctatcttggggacaaggttgtttattta
gacattcccaccaatgatgcctgggcgcgtgatactggcccaaccattctcgtcaatgat
aaaggtaagaaattagccgtggattgggccttcaatgcttggggaggcacctatgatggt
ctttatcaagattatgaagaggatgaccaagtagccagtcgttttgctgaggccttggaa
aggcctgtctatgatgctaaaccttttgtactggaaggaggcgcaatccatagcgatggt
caaggaactattctcgtaactgaaagttgcttgcttagtcctggtcgcaatcctaacctg
actaaagaggagattgaaaacacattattagaaagtcttggtgctgaaaaagttatttgg
cttccttatggtatttatcaggatgaaaccaatgaacacgtagataatgttgctgccttt
gttggtcctgctgaggttgttttggcttggacagatgacgaaaatgatccccagtatgcc
atgtcaaaagcagatctcgaactcttagaacaggaaacagatgcaaaaggttgtcacttc
accattcataaattgcctatccctgcagttcgacaagttgtgacagaagaagatttgcca
ggctacatctatgaagaaggagaagaagagcgatacgcaggtgaacgactagcagcttcc
tacgtaaacttttatatcgccaacaaggctgtcttggttccacagtttgaggatgtaaac
gaccaagtggccttagatatcctcagcaagtgtttcccagaccgtaaagttgtcggaata
ccagccagagatattctcttaggtggtggcaatatccactgtatcacccaacaaattcca
gaatag

DBGET integrated database retrieval system