KEGG   Streptococcus pneumoniae 670-6B (serotype 6B): SP670_1411Help
Entry
SP670_1411        CDS       T01308                                 

Definition
(GenBank) stress-responsive transcriptional regulator
Organism
snb  Streptococcus pneumoniae 670-6B (serotype 6B)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PspC SCFA_trans DUF4574
Motif
Other DBs
NCBI-ProteinID: ADM91469
Position
complement(1322604..1322876)
Genome map
AA seq 90 aa AA seqDB search
MNSKFYKMRRNRMISGVLAGLSDKWNFDVTLVRFLFAIFTVANFGLGVIIYIILASIMPT
KEEIEAEMYGTGPRKRKEAQAIDDNEGWFW
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtaagttttataaaatgagacgaaatcgcatgatttcaggagttttagcaggt
ctgtcagacaagtggaactttgatgttacccttgtacgttttctgtttgccatttttaca
gtcgcaaactttggacttggggtgattatctatatcatcctagcttctatcatgccaacc
aaggaagaaatcgaagcagaaatgtacggaacaggcccacgtaaacgcaaagaagctcaa
gccattgacgataatgaaggctggttttggtga

DBGET integrated database retrieval system