KEGG   Streptococcus pneumoniae 670-6B: SP670_1412Help
Entry
SP670_1412        CDS       T01308                                 

Definition
(GenBank) zinc-dependent metalloprotease
  KO
K03095  SprT-like protein
Organism
snb  Streptococcus pneumoniae 670-6B
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Zn_ribbon_SprT SprT-like FlhC HypA Zn-ribbon_8 DUF2197 Arb1
Motif
Other DBs
NCBI-ProteinID: ADM91470
Position
complement(1322934..1323257)
Genome map
AA seq 107 aa AA seqDB search
MDFNPKVYQELGLDVFRKIVRHELCHYHLYFQGKGYQHKDRDFKELLKAVDGLRFVPSLP
NSNSKPIKLYRCQSCQQRYQRKRRIDTQRYRCGLCRGKLLLVNQPED
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
ttggattttaatcccaaggtttatcaggaactggggttggacgtttttaggaaaattgtc
cgacatgaactctgtcattatcacctctattttcaagggaaaggctatcaacacaaggat
cgggattttaaggaactgttgaaagcagtggatggattacggtttgtaccatccttgccc
aatagtaactccaagccaatcaagctctatcgttgccaatcctgccagcaaaggtatcag
cgtaagcgtaggattgatacccaacgctatcgctgtggactttgtcgaggaaagttgcta
ttagtaaatcagcctgaggactga

DBGET integrated database retrieval system