KEGG   Streptococcus pneumoniae 670-6B (serotype 6B): SP670_1418Help
Entry
SP670_1418        CDS       T01308                                 

Definition
(GenBank) conserved hypothetical protein
Organism
snb  Streptococcus pneumoniae 670-6B (serotype 6B)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 BAAT_C Lipase_3 PGAP1 Abhydrolase_5 Hydrolase_4 LCAT DUF4416 Vps53_N DUF2974 UPF0227 DLH Abhydrolase_3
Motif
Other DBs
NCBI-ProteinID: ADM91476
Position
complement(1327758..1328474)
Genome map
AA seq 238 aa AA seqDB search
MKKYFISGLGSNAYHSKDFFQELDSQVYFLNPYEKHLRDETELKSWFKNEIVEEESICLI
GHSLGGDLARYFASEFEEVKKLILLDGGYLDLDKILPLDTELEETKNYIKSQIVSDLALL
ISKEKSEAKHWSENMEKAVRQSYHWNVEYNRYELAINYENIEAILRLRRKIQAFKREVGD
TLFISPRYPNGATWREEALKELPDYFNTIFLENFGHELYTQAPKEIASLMNEWLAYFL
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatattttattagcggtttgggaagcaatgcctatcatagcaaggattttttt
caagaactagattcgcaggtctattttctaaatccatatgaaaagcatcttcgagatgaa
acagaattgaaatcatggtttaaaaatgagattgtagaggaagaatctatctgtctgata
ggtcattctcttggaggagatttagctcgttatttcgcatcggaatttgaagaagtaaag
aaactgattcttttggatggtggctatctagatttagataagattttacctttggataca
gagttagaggaaactaaaaattatatcaaatctcaaattgtttcggacttagctcttctt
atttctaaagagaagtccgaagcaaagcattggtcagaaaatatggagaaagctgtaaga
cagtcctatcactggaatgttgagtataatagatatgagttggctataaattatgaaaat
atagaagcgatactccgcctacggagaaaaatacaagcttttaagagagaagtgggagat
accttgtttattagtcctcgctatcctaatggagctacatggagagaggaagccctaaaa
gaattgccagactattttaatactatttttttagaaaactttggccatgagctttatact
caagcacctaaagaaatcgctagtctaatgaatgagtggctcgcttattttctatga

DBGET integrated database retrieval system