KEGG   Streptococcus pneumoniae 670-6B (serotype 6B): SP670_1433Help
Entry
SP670_1433        CDS       T01308                                 

Definition
(GenBank) conserved hypothetical protein
Organism
snb  Streptococcus pneumoniae 670-6B (serotype 6B)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MazE_antitoxin
Motif
Other DBs
NCBI-ProteinID: ADM91491
Position
complement(1346911..1347147)
Genome map
AA seq 78 aa AA seqDB search
MVVKTRKQGNSITITIPSEFNIPSGVKYEAKLLPSGEIIFTPEELGQQVSYVSDDAFDLN
LDKIFDEYDDVFKALVEK
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atggtagtaaaaacaagaaaacaaggaaattcaatcactattacgattccaagtgaattt
aatattccaagtggtgttaaatacgaagcgaaattgttaccaagtggtgagattatcttt
actcctgaagaattggggcagcaggtttcttatgtatctgatgatgcctttgacttaaat
ttagataaaatatttgacgaatacgacgatgttttcaaagctttggtggaaaaatga

DBGET integrated database retrieval system