KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10001
Entry
HMPREF0837_10001  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Other DBs
NCBI-ProteinID: ADI68229
UniProt: D6ZMQ8
Position
113..256
AA seq 47 aa
MFSTTTYVVAPCTLVRLVQFSKVFVTCFSQATTILVYHSHFRLSTLF
NT seq 144 nt   +upstreamnt  +downstreamnt
ttgttcagtactacaacttatgttgtagcgccctgcacattggttcgtcttgttcagttt
tcaaaggtctttgtcacttgcttctctcaagcgacaactatattagtatatcacagccac
tttcgcttgtcaacacttttttga

DBGET integrated database retrieval system