KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10002
Entry
HMPREF0837_10002  CDS       T01259                                 

Gene name
comX
Definition
(GenBank) transcriptional regulator ComX1
  KO
K12296  competence protein ComX
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc02020  Two-component system
snc02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:snc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HMPREF0837_10002 (comX)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    HMPREF0837_10002 (comX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:snc03000]
    HMPREF0837_10002 (comX)
Transcription factors [BR:snc03000]
 Prokaryotic type
  Other transcription factors
   Others
    HMPREF0837_10002 (comX)
SSDB
Motif
Pfam: Sigma70_r2
Other DBs
NCBI-ProteinID: ADI68230
UniProt: D6ZMQ9
Position
complement(479..958)
AA seq 159 aa
MIKELYEEVQGTVYKCRNEYYLHLWELSDWDQEGMLCLHELISREEGLVDDIPRLRKYFK
TKFRNRILDYIRKQESQKRRYDKEPYEEVGEISHRISEGGLWLDDYYLFHETLRDYRNKQ
SKEKQEELERVLSNERFRGRQRVLRDLRIVFKEFTIRTH
NT seq 480 nt   +upstreamnt  +downstreamnt
atgattaaagaattgtatgaagaagtccaagggactgtttataagtgtagaaatgaatat
taccttcatttatgggaattgtcggattgggaccaagaaggcatgctctgcttacatgaa
ttgattagtagagaagaaggactggtagacgatattccacgtttaaggaaatatttcaaa
accaagtttcgaaatcgaattttagactatatccgtaagcaggaaagtcagaagcgtaga
tacgataaagaaccctatgaagaagtgggagagatcagtcatcgtataagtgaggggggt
ctctggctagatgattattatctctttcatgaaacactaagagattatagaaacaaacaa
agtaaagagaaacaagaagaactagaacgcgtcttaagcaatgaacgatttcgagggcgt
caaagagtattaagagacttacgcattgtgtttaaggagtttactatccgtacccactag

DBGET integrated database retrieval system