KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10003
Entry
HMPREF0837_10003  CDS       T01259                                 

Gene name
nusG
Definition
(GenBank) transcription termination/antitermination factor NusG
  KO
K02601  transcription termination/antitermination protein NusG
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:snc03021]
    HMPREF0837_10003 (nusG)
   03009 Ribosome biogenesis [BR:snc03009]
    HMPREF0837_10003 (nusG)
Transcription machinery [BR:snc03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     HMPREF0837_10003 (nusG)
Ribosome biogenesis [BR:snc03009]
 Prokaryotic type
  rRNA transcription factors
   HMPREF0837_10003 (nusG)
SSDB
Motif
Pfam: NusG KOW Pik1
Other DBs
NCBI-ProteinID: ADI68231
UniProt: D6ZMR0
Position
complement(1080..1631)
AA seq 183 aa
MKGNIMDSFDKGWFVLQTYSGYENKVKENLLQRAQTYNMLDNILRVEIPTQTVQVEKNGK
RKEVEENRFPGYVLVEMVMTDEAWFVVRNTPNVTGFVGSHGNRSKPTPLLEQEIRDILVS
MGQTVQEFDFDVEIGQTVRIIDGAFADYTGKITEIDNNKVKMIISMFGNDTVAEVNLNQI
AEL
NT seq 552 nt   +upstreamnt  +downstreamnt
atgaaaggaaatatcatggatagttttgataaaggatggtttgttttacaaacttattct
ggttatgaaaataaggtgaaagaaaatctattacaacgtgcacaaacctacaatatgttg
gataatattctacgcgttgaaattccaacacaaacagtgcaagttgaaaaaaatggaaag
agaaaagaagtagaagaaaatcgctttccaggttatgttcttgtagaaatggtcatgaca
gatgaagcttggtttgttgttcgaaacacaccaaatgttacaggatttgtcggatcacac
gggaacagatcaaaaccaactccattattggaacaagaaattcgtgacattttggtatct
atgggacaaactgttcaagaatttgatttcgatgttgagattggtcaaactgtacgtatt
attgatggtgcttttgcagactacactggtaagattacagaaattgataataacaaagtg
aaaatgattatctctatgtttggtaatgacacagttgcagaagtaaacctaaaccaaatc
gcagaattataa

DBGET integrated database retrieval system