KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10004
Entry
HMPREF0837_10004  CDS       T01259                                 

Gene name
secE
Definition
(GenBank) preprotein translocase, SecE subunit
  KO
K03073  preprotein translocase subunit SecE
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc02024  Quorum sensing
snc03060  Protein export
snc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:snc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    HMPREF0837_10004 (secE)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    HMPREF0837_10004 (secE)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    HMPREF0837_10004 (secE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:snc02044]
    HMPREF0837_10004 (secE)
Secretion system [BR:snc02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   HMPREF0837_10004 (secE)
SSDB
Motif
Pfam: SecE
Other DBs
NCBI-ProteinID: ADI68232
UniProt: D6ZMR1
Position
complement(1671..1847)
AA seq 58 aa
MRFIGDIFRLLKDTTWPTRKESWRDFRSIMEYTAFFVVIIYIFDQLIVSGLIRFINIF
NT seq 177 nt   +upstreamnt  +downstreamnt
atgcgttttattggagatatttttagacttcttaaagacacaacgtggccaactcgcaag
gaaagctggagagattttcgttctatcatggaatacacagctttctttgtagtaattatt
tacatttttgaccagttgattgtttcaggtttgattcgatttattaacattttttag

DBGET integrated database retrieval system