KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10005
Entry
HMPREF0837_10005  CDS       T01259                                 

Gene name
rpmG
Definition
(GenBank) ribosomal protein L33
  KO
K02913  large subunit ribosomal protein L33
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc03010  Ribosome
Brite
KEGG Orthology (KO) [BR:snc00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    HMPREF0837_10005 (rpmG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:snc03011]
    HMPREF0837_10005 (rpmG)
Ribosome [BR:snc03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    HMPREF0837_10005 (rpmG)
  Bacteria
    HMPREF0837_10005 (rpmG)
SSDB
Motif
Pfam: Ribosomal_L33 zf-RRN7 zinc_ribbon_2 Nudix_N_2 OrfB_Zn_ribbon
Other DBs
NCBI-ProteinID: ADI68233
UniProt: D6ZMR2
Position
complement(1857..2009)
AA seq 50 aa
MALKKASLACAVCGSRNYSIKISGNPKPTRLEVNKFCKHCGKYTTHRETR
NT seq 153 nt   +upstreamnt  +downstreamnt
atggcactaaaaaaagcaagcctagcttgtgcggtttgtggttcgagaaactattcaatc
aagatcagcggaaaccccaagcctacacgactagaagtaaataaattttgtaagcattgt
ggcaagtacactacacatagagaaacgagatag

DBGET integrated database retrieval system