KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10006
Entry
HMPREF0837_10006  CDS       T01259                                 

Definition
(GenBank) penicillin-binding protein, 1A family
  KO
K12555  penicillin-binding protein 2A [EC:2.4.1.129 3.4.16.4]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc00550  Peptidoglycan biosynthesis
snc01100  Metabolic pathways
snc01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:snc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HMPREF0837_10006
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    HMPREF0837_10006
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:snc01003]
    HMPREF0837_10006
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:snc01011]
    HMPREF0837_10006
Enzymes [BR:snc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     HMPREF0837_10006
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     HMPREF0837_10006
Glycosyltransferases [BR:snc01003]
 Polysaccharide
  Bacterial polysaccharide
   HMPREF0837_10006
Peptidoglycan biosynthesis and degradation proteins [BR:snc01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   HMPREF0837_10006
SSDB
Motif
Pfam: Transgly Transpeptidase
Other DBs
NCBI-ProteinID: ADI68234
UniProt: D6ZMR3
Position
complement(2062..4257)
AA seq 731 aa
MKLDKLFEKFLSLFKKETSELEDSDSTILRRSRSDRKKLAQVGPIRKFWRRYHLTKIILI
LGLSAGLLVGIYLFAVAKSTNVNDLQNALKTRTLIFDREEKEAGALSGQKGTYVELTDIS
KNLQNAVIATEDRSFYKNDGINYGRFFLAIVTAGRSGGGSTITQQLAKNAYLSQDQTVER
KAKEFFLALELSKKYSKEQILTMYLNNAYFGNGVWGVEDASKKYFGVSASEVSLDQAATL
AGMLKGPELYNPLNSVEDSTNRRDTVLQNMVAAGYIDKNQETEAAEVDMTSQLHDKYEGK
ISDYRYPSYFDAVVNEAVSKYNLTEEEIVNNGYRIYTELDQNYQANMQIVYENISLFPRA
EDGTFAQSGSVALEPKTGGVRGVVGQVADNDKTGFRNFNYATQSKRSPGSTIKPLVVYTP
AVEAGWALNKQLDNHTMQYDSYKVDNYAGIKTSREVPMYQALAESLNLPAVATVNDLGVD
KAFEAGEKFGLNMEKVDRVLGVALGSGVETNPLQMAQAYAAFANEGLMPEAHFISRIENA
SGQVIASHKNSQKRVIDKSVADKMTSMMLGTFTNGTGISSSPADYIMAGKTGTTEAVFNP
EYTSDQWVIGYTPDVVISHWLGFPTTDENHYLAGSTSNGAAHVFRNIANTILPYTSGSTF
TVENAYKQNGIAPANTKRQVQTNDNSQTDDNLSDIRGRAQSLVDEASRAISDAKIKEKAQ
TIWDSIVNLFR
NT seq 2196 nt   +upstreamnt  +downstreamnt
atgaaattagataaattatttgagaaatttctttctctttttaaaaaagaaacaagtgaa
ctagaggactctgattctactatcttacgtcgctctcgtagtgatcgaaaaaaattagcc
caagtaggtccgattcgaaaattctggcgtcgttatcatctaacaaagattatccttata
ctaggtttgagtgcaggattgctagttggaatctatttgtttgctgtagccaagtcgacc
aatgtcaatgatttgcaaaatgccttgaaaactcggactcttatttttgaccgtgaagaa
aaagaggctggtgccttgtctggtcaaaagggaacctatgttgagctgactgacatcagt
aaaaacttgcagaatgctgttattgcgacagaagaccgttctttctataaaaatgacggg
attaactatggccgtttcttcttggctattgtcactgctggacgttcaggtggtggctct
accattacccaacagctggctaaaaacgcctatttatcgcaggatcaaactgttgagaga
aaagcgaaagaatttttccttgccttagaattaagcaaaaaatatagtaaggagcaaatt
ctaaccatgtaccttaacaacgcttattttggaaatggtgtgtggggtgtagaagatgcg
agtaagaaatactttggagtttctgcatcagaagtgagtctggatcaagctgcgactctg
gcagggatgctcaaggggccggaactgtataatcccttgaattctgtagaagattctact
aatcggcgcgatactgtcttgcagaatatggttgcagcaggatatattgataaaaaccaa
gaaaccgaagctgctgaagttgatatgacttcgcaattgcacgataagtatgaaggaaaa
atctcagattaccgttacccctcttattttgatgcggtggttaatgaagctgtttccaag
tataatctaacagaggaagagattgtcaataatggctaccgcatttacacagagctggac
caaaactaccaagcaaatatgcagattgtttatgaaaacatatcgctatttccgagggca
gaggatggaacgtttgctcaatcaggaagtgtagctctcgaaccgaaaacagggggagtt
cgtggagttgtcggtcaagttgctgacaatgataaaactggattccggaatttcaactat
gcaacccaatcaaagcgtagtcctggttctacaattaagcctttagttgtttatacgcca
gcagttgaagcaggctgggctttgaataagcagttggataaccataccatgcagtatgac
agctataaggttgataactatgcagggatcaaaacgagtcgagaagttcctatgtatcaa
gccttggcagaatcgcttaatctacctgctgttgccactgttaatgatttgggtgtcgac
aaggcttttgaggcaggcgaaaaattcggactcaacatggaaaaggttgaccgtgttctt
ggtgtcgccttgggaagcggtgttgaaaccaaccctcttcaaatggctcaagcatacgcc
gcctttgcaaatgaaggtttaatgcctgaagctcattttattagtagaattgaaaatgct
agtggacaagttattgcgagtcataaaaattcacaaaaacgggtgattgataagtctgta
gctgacaagatgaccagtatgatgttggggactttcaccaacggtaccggtattagttca
tcgcctgcagactatattatggcagggaaaactggaacaactgaagcagtttttaatccg
gagtacacaagtgaccagtgggtaattggttatactccggatgtagtgattagccactgg
cttggctttccgaccactgatgaaaaccactatctagctggctctacttcaaacggtgca
gctcatgtctttagaaacattgccaataccattttaccttatacgtcaggaagtaccttt
acggttgaaaatgcttataagcaaaatggaattgcaccagccaatacaaaaagacaagta
caaaccaatgataatagccagacagatgataatttgtctgatattcgagggcgtgcgcaa
agtctagtagatgaggctagccgggctatctcagatgcgaagattaaggaaaaggctcaa
acaatatgggattcgatagtcaatctatttcgctaa

DBGET integrated database retrieval system