KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10007
Entry
HMPREF0837_10007  CDS       T01259                                 

Definition
(GenBank) pseudouridine synthase, RluA family
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:snc03009]
    HMPREF0837_10007
Enzymes [BR:snc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     HMPREF0837_10007
Ribosome biogenesis [BR:snc03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    HMPREF0837_10007
SSDB
Motif
Pfam: PseudoU_synth_2 PA14
Other DBs
NCBI-ProteinID: ADI68235
UniProt: D6ZMR4
Position
4344..5219
AA seq 291 aa
MQFTFTLPASLPQMTVKQLLEEQLLIPRKIRHFLRIKKHILINQEEVHWNEIVNPGDVCQ
LTFDEEDYSQKTIPWGNPDLVQEVYQDQHLIIVNKPEGMKTHGNQPNEIALLNHVSTYVG
QTCYVVHRLDMETSGLVLFAKNPFILPILNRLLEKKEISREYWALVDGNINRKELVFRDK
IGRDRHDRRKRIVDAKNGQYAETYVSRLKQFSNKTSLAHCKLKTGRTHQIRVHLSHHNFP
ILGDPLYNSNSKTSRLMLHAFRLSFTHPLTLEKLNFTALSNTFETELKKNG
NT seq 876 nt   +upstreamnt  +downstreamnt
atgcaattcacatttacattacccgcctctctacctcaaatgacggtaaagcaattactt
gaggaacaactcctcatccctagaaaaatccgtcattttttgagaatcaagaaacatatt
ttgataaatcaagaagaagtccactggaacgaaatcgtaaatcctggagatgtttgccag
ttgacttttgacgaggaagattattcccaaaagacgatcccttggggcaacccagactta
gtgcaggaagtttatcaagatcaacacttgattattgtaaacaaaccagaggggatgaaa
acgcatggtaatcaaccaaacgaaattgcccttcttaaccatgtcagtacctatgttggc
caaacctgctatgtcgttcatcgtctggacatggaaaccagtggcttagttctctttgcc
aaaaatccttttatcctgcccattctcaatcgcttattggagaaaaaagagatttctaga
gaatattgggctctagttgatggaaatatcaacagaaaagaacttgttttcagagacaaa
attggacgtgatcgccatgatcgtagaaaaagaatagttgatgcaaaaaatgggcaatat
gctgaaacgtatgtaagcagattaaagcaattctcaaacaagacttccttggctcattgc
aagctaaagacagggcgaacccatcagattcgtgtgcacctttcgcatcataacttccct
attttgggcgaccctctctataacagcaattcaaagacaagtcggcttatgcttcatgcc
tttcgactttcctttacccatccacttacattagaaaaattaaacttcactgccctctca
aatacttttgaaacagaattaaaaaagaatggatga

DBGET integrated database retrieval system