KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10008
Entry
HMPREF0837_10008  CDS       T01259                                 

Gene name
gap
Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type I
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc00010  Glycolysis / Gluconeogenesis
snc01100  Metabolic pathways
snc01110  Biosynthesis of secondary metabolites
snc01120  Microbial metabolism in diverse environments
snc01200  Carbon metabolism
snc01230  Biosynthesis of amino acids
Module
snc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
snc_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:snc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0837_10008 (gap)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:snc04131]
    HMPREF0837_10008 (gap)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:snc04147]
    HMPREF0837_10008 (gap)
Enzymes [BR:snc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     HMPREF0837_10008 (gap)
Membrane trafficking [BR:snc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    HMPREF0837_10008 (gap)
Exosome [BR:snc04147]
 Exosomal proteins
  Proteins found in most exosomes
   HMPREF0837_10008 (gap)
SSDB
Motif
Pfam: Gp_dh_C Gp_dh_N 2-Hacid_dh_C
Other DBs
NCBI-ProteinID: ADI68236
UniProt: D6ZMR5
Structure
PDB: 
5M6D

Position
complement(5288..6322)
AA seq 344 aa
MIFIRRKSLMVVKVGINGFGRIGRLAFRRIQNVEGVEVTRINDLTDPVMLAHLLKYDTTQ
GRFDGTVEVKEGGFEVNGKFVKVSAERDPEQIDWATDGVEIVLEATGFFAKKEAAEKHLK
GGAKKVVITAPGGNDVKTVVFNTNHDVLDGTETVISGASCTTNCLAPMAKALQDNFGVVE
GLMTTIHAYTGDQMILDGPHRGGDLRRARAGAANIVPNSTGAAKAIGLVIPELNGKLDGS
AQRVPTPTGSVTELVAVLEKNVTVDEVNAAMKAASNESYGYTEDPIVSSDIVGMSYGSLF
DATQTKVLDVDGKQLVKVVSWYDNEMSYTAQLVRTLEYFAKIAK
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgattttcataaggaggaaatcactaatggtagttaaagttggtattaacggtttcgga
cgtatcggtcgtcttgctttccgtcgtatccaaaacgtagaaggtgttgaagttacacgc
atcaacgaccttacagatccagttatgcttgcacacttgttgaaatacgacacaactcaa
ggtcgtttcgacggtactgttgaagttaaagaaggtggattcgaagttaacggtaaattc
gttaaagtttctgctgaacgtgatccagagcaaatcgactgggctactgacggtgtagaa
atcgttcttgaagctactggtttctttgctaagaaagaagcagctgaaaaacaccttaaa
ggtggagctaaaaaagttgttatcactgctcctggtggaaacgacgttaaaacagttgta
ttcaacactaaccacgacgttcttgacggtactgaaacagttatctcaggtgcttcatgt
actacaaactgcttggctccaatggctaaagctcttcaagataactttggtgttgttgaa
ggattgatgactactatccacgcttacactggtgaccaaatgatccttgacggaccacac
cgtggtggtgaccttcgccgtgctcgcgctggtgctgcaaacatcgttcctaactcaact
ggtgctgctaaagctatcggtcttgtaatcccagaattgaacggtaaacttgacggatct
gcacaacgcgttccaactccaactggatcagttactgaattggtagcagttcttgaaaag
aacgttactgttgatgaagtgaacgcagctatgaaagcagcttcaaacgaatcatacggt
tacacagaagatccaatcgtatcttcagatatcgtaggtatgtcttacggttcattgttt
gacgcaactcaaactaaagttcttgacgttgacggtaaacaattggttaaagttgtatca
tggtacgacaacgaaatgtcatacactgcacaacttgttcgtactcttgaatacttcgca
aaaattgctaaataa

DBGET integrated database retrieval system