KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10009
Entry
HMPREF0837_10009  CDS       T01259                                 

Definition
(GenBank) efflux ABC transporter, permease protein
  KO
K02004  putative ABC transport system permease protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:snc02000]
    HMPREF0837_10009
Transporters [BR:snc02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Putative ABC transporter
    HMPREF0837_10009
SSDB
Motif
Pfam: FtsX LptF_LptG EI24 Tudor_3 Peptidase_M13_N
Other DBs
NCBI-ProteinID: ADI68237
UniProt: D6ZMR6
Position
complement(6475..7437)
AA seq 320 aa
MNMSNITIDGQEMDLSQTMPSYAQVVSLYDDTSISVSNNETDKVLAGSLYTDTNEQGLTI
PSSLLKNWNEQTGKNLTANDLIGKSVSASIVESAAETSKIAQFQTKIVRVINDEDDMEDS
NSFMLSHQMETISKEAGFTKAVSYFILELKDPSQTKVVTEELQKNKKYTVLSQQRVLDIV
ITFIRVIQGLLIVLSSQAIVVAAVMIGIIIYINIMQRSKEIGVMKAVGYQNRDVKGIFIY
EAIWIVGIALLLAFLVAQGVGSLANAIVSHFYPSIAKVFELNLLSVLGTLVFALLLGYVS
AYFPARKISKMDPVESLRYE
NT seq 963 nt   +upstreamnt  +downstreamnt
atgaacatgtcaaatattactatagatgggcaagaaatggatctgagtcaaacgatgcct
tcttatgctcaagtagtgagtctttatgatgatacaagtatctctgttagtaataatgag
acggacaaagtgttggctggctccctctatactgatacaaatgaacagggattaacgatt
ccaagcagtttactaaaaaattggaatgaacagacaggaaaaaatttgacagctaatgat
cttattggcaaatcagtctcagccagcattgtagaaagtgctgccgaaactagtaagatt
gctcaatttcaaacgaagattgtacgtgtaatcaatgatgaagatgacatggaggacagc
aacagtttcatgctgtctcatcaaatggaaacgatttcgaaagaggctggatttacgaaa
gctgtatcttattttatcttggaactcaaagatccatcacagacaaaagtagtaacagaa
gaattacagaaaaataagaagtatactgtgctttctcaacagagagttcttgatattgtg
attacctttattcgtgttattcagggattattgattgtgctttcatcacaagctattgtg
gtagcagcggttatgattggtatcattatttacatcaatatcatgcaacgttccaaggaa
ataggtgtcatgaaggcagttggctatcagaatcgtgatgtcaaaggaatttttatttac
gaggctatctggattgtaggaatcgccttgctactggcttttttggtagcacaaggggtg
ggaagtttagcgaatgcgattgtaagtcacttttacccatccatcgctaaggtctttgaa
ttaaatttgttatctgttttaggaactctagttttcgctctcttgcttggctatgtatca
gcctacttcccagcacgtaaaattagtaaaatggaccctgtagaatcgctacgctatgaa
tag

DBGET integrated database retrieval system