KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10010
Entry
HMPREF0837_10010  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: DDE_3 DDE_Tnp_ISAZ013 DDE_1
Other DBs
NCBI-ProteinID: ADI68238
UniProt: D6ZMR7
Position
complement(7498..7836)
AA seq 112 aa
MVAGLTNGELIAPMTYEEMMTSDFFEAWFQKFLLPTLTTPSVIIMDNARFHRMGKLELLC
EEFGHKLLPLPPYSPEYNPIEKTWAHIKKHLKKVLPSCNTFYEAFLSCSCFN
NT seq 339 nt   +upstreamnt  +downstreamnt
ttggttgcaggtctaacaaatggtgagttaatcgctccaatgacttacgaagagatgatg
acgagcgacttttttgaagcttggtttcagaagtttctcttaccaacattaaccacacca
tcggttattattatggataatgcaagattccatagaatgggtaagttagaacttttatgc
gaggagtttgggcataaacttttacctcttcctccctactcacctgagtacaatcctatt
gagaaaacatgggctcatatcaaaaagcacctcaaaaaggtattaccaagttgcaatacc
ttttacgaggcttttttatcctgctcttgtttcaattga

DBGET integrated database retrieval system