KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10011
Entry
HMPREF0837_10011  CDS       T01259                                 

Definition
(GenBank) transposase
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: HTH_Tnp_IS630 HTH_28 HTH_23 HTH_29 HTH_17 HTH_Tnp_ISL3 HTH_30 HTH_38 HTH_Tnp_1_2 HTH_PafC HTH_IclR DUF658 HTH_22 YrzK PemK_toxin
Other DBs
NCBI-ProteinID: ADI68239
UniProt: D6ZMR8
Position
complement(8016..8363)
AA seq 115 aa
MWYNLLMAYSIDFRKKVLSYCERTGSITEASHVFQISRNTIYGWLKLKEKTGELNHQVKG
TKPRKVDRDRLKNYLTDNPDAYLTEIASEFGCHPTTIHYALKAMGYTRKKEPHLL
NT seq 348 nt   +upstreamnt  +downstreamnt
atgtggtataatcttcttatggcatattcaatagattttcgtaaaaaagttctctcttat
tgtgagcgaacaggtagtataacagaagcatcacacgttttccaaatctcacgtaatacc
atttatggctggttaaagctaaaagagaaaacaggagagctaaaccaccaagtaaaagga
acaaaaccaagaaaggttgatagagatagacttaaaaactatcttactgacaatccagac
gcttatttgactgaaatagcttctgaatttggctgtcatccaactaccatccactatgcg
ctcaaagctatgggctacactcgaaaaaaagaaccacacctactatga

DBGET integrated database retrieval system