KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10012
Entry
HMPREF0837_10012  CDS       T01259                                 

Gene name
nadC
Definition
(GenBank) nicotinate-nucleotide diphosphorylase (carboxylating)
  KO
K00767  nicotinate-nucleotide pyrophosphorylase (carboxylating) [EC:2.4.2.19]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc00760  Nicotinate and nicotinamide metabolism
snc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    HMPREF0837_10012 (nadC)
Enzymes [BR:snc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.19  nicotinate-nucleotide diphosphorylase (carboxylating)
     HMPREF0837_10012 (nadC)
SSDB
Motif
Pfam: QRPTase_C QRPTase_N
Other DBs
NCBI-ProteinID: ADI68240
UniProt: D6ZMR9
Position
complement(8476..9375)
AA seq 299 aa
MILKIEDLVMSIISTDLTPFQIDDTLKAALREDVHSEDYSTNAIFDHHGQAKVSLFAKEA
GVLAGLTVFQRVFTLFDAEVTFQNPHQFKDGDRLTSGDLVLEIIGSVRSLLTCERVALNF
LQHLSGIASMTAAYVEALGDDCIKVFDTRKTTPNLRLFEKYAVRVGGGYNHRFNLSDAIM
LKDNHIAAVGSVQKAIAQARAYAPFVKMVEVEVESLAAAEEAAAAGADIIMLDNMSLEQI
EQAITLIAGRSRIECSGNIDMTTISRFRGLAIDYVSSGSLTHSAKSLDFSMKGLTYLDV
NT seq 900 nt   +upstreamnt  +downstreamnt
gtgatattaaaaatagaggacttagtgatgtcaatcatttcaactgatttaacccctttt
caaatagatgatacattgaaagcagccttgcgagaagatgttcattccgaagattacagt
accaatgccatttttgatcatcatggccaagccaaggtgtcgctttttgccaaggaagct
ggtgttttagcgggactaaccgtttttcaaagggtttttaccctatttgatgccgaggtg
accttccagaatcctcatcaatttaaggatggggatcgtttgactagtggcgatttggtt
ttagaaatcataggctcggtgagaagtctcttaacatgtgaacgcgttgccttgaatttt
ttacaacatttatcagggattgcttcgatgacagctgcttatgtagaagccttaggcgat
gattgcattaaggtatttgatactcgaaaaactactcctaatttacgtctttttgagaaa
tatgccgtgagagttggcggtggctataatcatcgctttaatttatcagatgctatcatg
ctaaaagacaatcacattgcggcagtaggtagtgttcagaaggcaattgctcaagcgcgt
gcctatgccccttttgtgaaaatggtcgaggtggaagtggaaagccttgctgctgccgaa
gaagctgcggcggcgggtgctgatattatcatgttggataatatgtcattggaacagatt
gaacaggccattaccctaattgcaggacgttctcggattgaatgttctggaaatattgat
atgaccactattagccgttttcgtggtttagcgattgattacgtctccagtggtagttta
acccatagtgctaagagtcttgatttttccatgaagggtttaacctaccttgatgtctaa

DBGET integrated database retrieval system