KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10013
Entry
HMPREF0837_10013  CDS       T01259                                 

Definition
(GenBank) dicarboxylate carrier MatC domain protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: MatC_N CitMHS
Other DBs
NCBI-ProteinID: ADI68241
UniProt: D6ZMS0
Position
9585..10895
AA seq 436 aa
MIHLIMISAIALAIGIGYRTKINIGLLAIAFSYLIATTLMGLSPKELLHFWPTSLFFTIF
SVSLFYNVATTNGTLDVLAQHILYRTRTHPNALYMILYLMATLLSALGAGFFTTMAVCCP
LAITLCQKADKHPLIGAQAVNWGASGGANLITSSSGIVFQGLFKQMGWEEQAFSLGNHIF
IVSIIYPLIVLLLLSCYSHYSKGRTNSSLTIDQPPLLSKVQRQTTLLMISSMVLVWLFPL
LHLIFPNIAWIATYQKTFDIGFVSILMVCLALRLKLGKQEAILAKVPWATIIMLCGMSLL
MSLAVKSGLVTLIGHLMTTTIPHFWLPLFFCVIAGVMSLFSSTLSVVAPALFPIIAIISA
QNPQIDIHLLTTATVIGALSTNISPFSSAGSLIQLSLPNIEERGLAFKKQIILGVPISLS
LGLLTTWILILLASLS
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgattcatttaataatgattagcgccattgctctagccattggaattggttaccgcacc
aaaatcaatattggcctgctggctattgctttttcttacctcatcgcaaccactctcatg
ggattaagccccaaagaacttcttcatttttggccaacctcactcttttttaccattttt
agcgtctctctcttttataacgttgcaacaactaacggtactcttgatgttttggctcaa
cacattctctaccgcacacgcacccaccctaacgccctctacatgattttatacctgatg
gcaacccttttgtctgctttaggtgctggatttttcactactatggccgtttgctgtcct
ctagcgattaccctctgtcaaaaagcggacaaacaccctttgattggagctcaagccgtc
aattggggagcttcaggaggggctaatttgataaccagtagctcaggcattgtctttcaa
ggcctgtttaagcaaatgggatgggaagagcaagctttttcacttggcaatcatatcttt
atcgtcagcattatctacccactcatcgtcttgcttttattatcctgttacagtcactat
agtaagggaagaacaaactcatccttgactattgaccaaccaccactcctcagcaaggtt
caaagacaaaccaccttgctcatgatcagcagcatggttttggtttggctttttcccttg
ttgcatctcattttcccaaacatcgcctggatagctacttatcaaaaaacatttgatatt
ggctttgtctcaatactcatggtctgcctcgccttaaggctcaaattagggaagcaagaa
gccattttagctaaggttccctgggctacaattatcatgctctgcggcatgagcttacta
atgtctctagcggtcaagtcaggtttagtcacactgatagggcacctcatgacaacaacc
attcctcatttctggttacctctgttcttttgtgtgatagccggagtgatgtcactcttt
agttccaccctatccgttgtagctccagccctctttcccatcattgctatcatcagtgct
caaaatcctcagattgatattcacttactcacaacagccaccgttattggcgctctatct
actaatatctcacccttttcatcagctggttctctcattcaactctcacttcccaatata
gaggaacgtggccttgccttcaaaaagcaaattattctgggtgtccccatcagcttaagt
ttgggactcttgaccacctggattctcatccttctagcttccttaagttag

DBGET integrated database retrieval system