KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10014
Entry
HMPREF0837_10014  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: AAA_29 AAA_23 ABC_tran AAA_27 AAA_21 RsgA_GTPase SMC_N AAA_16 AAA_15 AAA_30 ABC_ATPase AAA_22 T2SSE AAA_25
Other DBs
NCBI-ProteinID: ADI68242
UniProt: D6ZMS1
Position
complement(11261..11455)
AA seq 64 aa
MKGKEYENRTVSFAISSKGEKMKVENISYRVDHRILFDNISFDTSSSGVTLITGKNGTGK
STLL
NT seq 195 nt   +upstreamnt  +downstreamnt
atgaaggggaaagagtatgaaaacagaactgtttcttttgctattagttcaaaaggagaa
aaaatgaaagtagaaaatatttcgtatagggtggatcatcgtatattgtttgataatatt
tcttttgatacttcgagttcaggcgtgacattaattactggtaaaaatggtacaggaaag
tcaactttactatag

DBGET integrated database retrieval system