KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10015
Entry
HMPREF0837_10015  CDS       T01259                                 

Definition
(GenBank) UbiC transcription regulator-associated domain protein
  KO
K03492  GntR family transcriptional regulator
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:snc03000]
    HMPREF0837_10015
Transcription factors [BR:snc03000]
 Prokaryotic type
  Helix-turn-helix
   GntR family
    HMPREF0837_10015
SSDB
Motif
Pfam: UTRA GntR HTH_11 HTH_36 MarR HTH_41 HTH_DeoR
Other DBs
NCBI-ProteinID: ADI68243
UniProt: D6ZMS2
Position
complement(11915..12643)
AA seq 242 aa
MSTKYLFIYNEIREKILCNKYTMNEQLPDEMTLAKQFACSRMTIKKALDLLVSEGLIFRK
RGQGTFVLSRGSSKRKLIVPERDIRGLTKISEDAHSTIDSRIIHFKLEFANEFLAEKLQV
ALQSPVYNIYRLRIIDGKPYVLEQTYMSTDVIPGITEDILQKSIYNYIEGKLGLHIASAT
KILRASSSSENEQHYLQLLPTEPVFEVEQVAYLDNGTPFEYSISRHRYDLFEFNSFALRH
SS
NT seq 729 nt   +upstreamnt  +downstreamnt
atgagtacaaaatatttatttatttacaatgagattcgtgaaaagattctttgtaataaa
tataccatgaacgaacaattacctgatgaaatgacattagctaaacagtttgcctgtagt
cgaatgacgatcaaaaaagctttagacttgttagtttctgagggcttaatttttagaaaa
cgtgggcagggaacctttgttctctctcgtggcagctcaaaaagaaaattaatcgttcca
gaaagagatatccggggactgacaaaaatatctgaagatgctcattctacaattgactcg
aggattattcacttcaaattagaatttgcaaatgaatttttagcagaaaaactacaggtc
gctttgcagagtccagtttataatatttaccgcctgcgtattattgacggtaaaccttat
gttctggaacaaacttatatgagtaccgatgttattccaggtattactgaagatatttta
caaaaatcgatttacaattacattgaaggaaagttaggattgcatattgccagtgctaca
aaaatcttacgagcttcttctagttcagaaaatgagcaacattacttgcagctccttcca
acggaaccggtatttgaagtagaacaagtggcttatttggataacggaactccgtttgag
tactcgattagtcgtcatcgctatgatttatttgaatttaattcttttgcattacgacat
tcctcctag

DBGET integrated database retrieval system