KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10016
Entry
HMPREF0837_10016  CDS       T01259                                 

Definition
(GenBank) glycosyl hydrolase, family 1
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc00010  Glycolysis / Gluconeogenesis
snc00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:snc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0837_10016
   00500 Starch and sucrose metabolism
    HMPREF0837_10016
Enzymes [BR:snc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     HMPREF0837_10016
SSDB
Motif
Pfam: Glyco_hydro_1 Cellulase
Other DBs
NCBI-ProteinID: ADI68244
UniProt: D6ZMS3
Position
12801..14210
AA seq 469 aa
MKKKLVFPNLFWWGAASSGPQTEGQYGKVHENVMDYWFKTHPEDFFDNVGPLVASNFFHT
YTEDFHLMKEIGVNSFRTSIQWSRLIKNLETGEPDPKGIAFYNAIIEEAKKNQMDLVMNL
HHFDLPVELLQKYGGWESKHVVELFVKFAKTAFTCFGDKVHYWTTFNEPMVIPEAGYLYA
FHYPNLKGKGKEAVQVIYNLNLASAKVIQLYRSLELDGKIGIILNLTPAYPRSNSPEDLE
ASRFTDDFFNKVFLNPAVKGTFPERLVKQLERDGVLWSHTEKELQLMKSNTVDFLGVNYY
HPKRVQAQANPEEYQTPWMPDQYFKEYEWPERRMNPYRGWEIFPKSIYDIAMIVKEEYGN
IPWFISENGMGVENEARFIDENGVIDDVYRIEFYEEHLRWLHKAIEEGSHCFGYHAWTAF
DCWSWNNAYKNRYGFISVDLETQKRTIKSSGRWYRKVSDNNGFEVEIEE
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgaaaaaaaagttagtatttcctaatctgttttggtggggagcagcttctagcggacct
cagacagaaggtcaatatggaaaagtacatgaaaatgtgatggactactggttcaaaacg
catccagaagattttttcgataatgtcggacctcttgtagccagtaacttttttcatact
tacaccgaagatttccacttgatgaaggaaattggagttaattctttccgcacttccatc
caatggagtcgactcatcaagaatttagagacaggtgagcctgatccaaaaggtattgct
ttctacaatgccatcattgaagaagctaaaaagaaccagatggatcttgtgatgaattta
catcattttgatttaccagtggaacttcttcaaaaatacggtggttgggaaagcaaacat
gtagtggagttattcgtgaagtttgccaagactgctttcacatgctttggagataaggtt
cattactggacaactttcaatgagccaatggtcattccagaagcaggatacttatatgct
ttccattatccaaatctaaaaggaaagggaaaagaggccgtacaagtcatctataatcta
aaccttgctagtgcaaaagtgattcaactatatcgctcattagaacttgatggaaagatt
gggattattttaaacttgacacctgcttatccaagaagtaattctccagaagacttagaa
gcaagtcgatttacagatgacttctttaacaaagtcttcttgaatccagctgttaaagga
actttcccagaaagattggtaaaacagctagagagagatggcgtgttatggagtcatacc
gaaaaagagcttcaactgatgaaatcaaatacggttgattttcttggagtaaactactac
catccaaaacgtgttcaagcacaagcaaatcctgaggaatatcagacgccctggatgcca
gaccaatacttcaaagagtatgaatggccggagcgtcgcatgaatccatatcgtggttgg
gaaatttttccgaaatccatttatgatattgctatgattgtgaaggaagaatatggtaat
atcccatggtttatcagtgaaaacggaatgggtgttgaaaacgaagcacggtttatcgat
gaaaatggagttatcgatgacgtgtatcgtattgaattttatgaagaacatttaagatgg
ctacataaagccattgaagagggaagtcactgttttggataccacgcttggaccgcattt
gattgctggtcttggaataatgcatataagaatcgttacggatttatctccgttgattta
gaaacgcaaaagagaaccatcaagagctcaggaagatggtatcgcaaagtaagtgacaat
aacggttttgaagtagaaattgaggagtaa

DBGET integrated database retrieval system