KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10017
Entry
HMPREF0837_10017  CDS       T01259                                 

Definition
(GenBank) putative PTS system, cellobiose-specific IIC component
  KO
K02761  cellobiose PTS system EIIC component
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc00500  Starch and sucrose metabolism
snc02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HMPREF0837_10017
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    HMPREF0837_10017
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:snc02000]
    HMPREF0837_10017
Transporters [BR:snc02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Cellobiose-specific II component
    HMPREF0837_10017
SSDB
Motif
Pfam: PTS_EIIC DUF347
Other DBs
NCBI-ProteinID: ADI68245
UniProt: D6ZMS4
Position
14228..15523
AA seq 431 aa
MKNSKFIDQFATFAGKLGNQIHLKTLRDAFVTVMPLYILAGLIVLLNNTVFKWIFQGDTL
TRFQYWGITIANGTLSISGMIIAVMVGYFLAKNRDFENPLAASMLSLVSLIVMMPNTVSV
VPDGAKDAVNISGVLSFNNTGTGAMFAGVIVAIIATELFIELSNVKALQMNLGENIPPAV
SRSFSVLLPVMTVISLFGVVSALLFNITGMNLISIITIFIQEPIRHIGTSLIGVIIIYSL
GNMLWLFGIHQAVIYSAILEPLLLINITENITAANNGQAIPHIINLSQIQTFALMGGSGS
TLCLLIATFLVSRNAVSKNVAKLSFGPGIFNINEPVLFGYPIVYNISLAIPFITVPVLGI
LISYLATVTGFMSPAFIQVPWTTPVFLNAWLATAGDVRAVLVQFIIFALGVLLYIPFIKV
NDKVVEQEMEG
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgaaaaactcaaaatttatagaccaatttgccacctttgctggtaaactagggaaccaa
attcatttaaaaaccctaagagatgcattcgtaacagtaatgccattatatattttggca
ggtttaatcgttcttttgaacaacacggtatttaagtggattttccaaggggatacatta
acaagattccaatattggggaataacaattgcaaacggtactttaagtatttcaggtatg
attattgctgtaatggttggttatttcttagctaaaaacagagatttcgaaaacccgtta
gcagcatcaatgctatcattagtttctttaattgtgatgatgccaaatacagtttctgta
gttcctgacggagcaaaagatgctgtaaacatttcaggtgttctttcattcaacaacaca
ggtacaggcgcaatgttcgccggggttatcgtagcgattattgcaacagaattattcatt
gaattatcaaatgttaaagctttacaaatgaaccttggtgaaaatattccaccagctgtt
agtagatcatttagcgtattacttccagtcatgaccgtcatctccttatttggggttgtt
tcagcattattattcaatataactggaatgaacttaatctcaatcattacaatctttatt
caagaaccaattcgtcatattggtacaagcttaatcggggtcattattatttactcttta
ggaaatatgttatggctatttggtattcaccaagcagttatttacagtgccatcctagaa
ccattactattaattaacattactgaaaacatcactgcagcaaataatggacaagccatt
ccacacatcatcaacctatcacaaatacaaacattcgctttaatgggtggtagtggatct
acattatgtttattaatagcaacattcttagtgagtcgcaatgctgtctctaaaaacgtg
gctaaattatcttttggacctggtatcttcaatatcaatgaaccagtattattcggttac
ccaatcgtttataacatttcattagctattccatttatcacagttccagtccttggtatt
ttaatcagctacttagcaacagttacaggattcatgagtcctgcatttatacaagttcct
tggactacaccagtattcttaaatgcatggttagcaacagcaggggacgtgagagcagtt
ctagttcaattcatcatctttgcacttggagttcttctatacattccatttatcaaagtt
aatgacaaagttgttgaacaagaaatggaaggttaa

DBGET integrated database retrieval system