KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10018
Entry
HMPREF0837_10018  CDS       T01259                                 

Definition
(GenBank) PTS system, Lactose/Cellobiose specific IIB subunit
  KO
K02760  cellobiose PTS system EIIB component [EC:2.7.1.196 2.7.1.205]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc00500  Starch and sucrose metabolism
snc02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HMPREF0837_10018
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    HMPREF0837_10018
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:snc02000]
    HMPREF0837_10018
Enzymes [BR:snc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.196  protein-Npi-phosphohistidine---N,N'-diacetylchitobiose phosphotransferase
     HMPREF0837_10018
    2.7.1.205  protein-Npi-phosphohistidine---cellobiose phosphotransferase
     HMPREF0837_10018
Transporters [BR:snc02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Cellobiose-specific II component
    HMPREF0837_10018
SSDB
Motif
Pfam: PTS_IIB
Other DBs
NCBI-ProteinID: ADI68246
UniProt: D6ZMS5
Position
15489..15836
AA seq 115 aa
MTKLLNKKWKVKIMKQILLVCNAGMSTSMLVKKMQQSATERGIEISIQAKSMTEAKKNIH
EADVILIGPQIRYELLAVKEIAGNIPVDTIDMRDYGMMNGAKVLEQALAWIGEIR
NT seq 348 nt   +upstreamnt  +downstreamnt
atgacaaagttgttgaacaagaaatggaaggttaagattatgaaacaaattttattagta
tgtaatgcgggaatgtcgacaagtatgcttgttaaaaaaatgcaacaaagtgcgactgaa
cgtgggattgaaatctctatccaagcaaaatcaatgacagaagctaaaaagaatatccat
gaagcagatgtcattctaattgggccacaaattcgttatgagttacttgctgtgaaagaa
attgcaggaaatatccctgtagataccattgatatgcgggattacggaatgatgaatgga
gcaaaagttctggaacaagcacttgcatggataggagaaataagatga

DBGET integrated database retrieval system