KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10021
Entry
HMPREF0837_10021  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Other DBs
NCBI-ProteinID: ADI68249
UniProt: D6ZMS8
Position
complement(19981..20118)
AA seq 45 aa
MKELLNKAFFNKNKASLSKEVLLESQGKRLPVNPFLSKSLFQASL
NT seq 138 nt   +upstreamnt  +downstreamnt
atgaaggaacttttaaacaaggcgtttttcaacaaaaataaagcctccttatcaaaggag
gtattattagaatcacaaggtaagcgcttacctgtaaatccctttctttccaaatccctc
ttccaagcaagtttgtga

DBGET integrated database retrieval system