KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10023
Entry
HMPREF0837_10023  CDS       T01259                                 

Definition
(GenBank) low molecular weight phosphotyrosine protein phosphatase
  KO
K01104  protein-tyrosine phosphatase [EC:3.1.3.48]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:snc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HMPREF0837_10023
Enzymes [BR:snc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     HMPREF0837_10023
SSDB
Motif
Pfam: LMWPc
Other DBs
NCBI-ProteinID: ADI68251
UniProt: D6ZMT0
Position
complement(20490..20870)
AA seq 126 aa
MAEFVMKSMTDNYEIQSRATSSWEHGNPIHKGTQGIFQEYEIPYDKNKTSLQISKEDFEA
FDYIIGMDASNISDLRQMCPVDCQDKIYSFSSESVPDPWYTGDFEETYRRVQEGCQAWLE
RLEKES
NT seq 381 nt   +upstreamnt  +downstreamnt
atggccgagtttgttatgaaatcaatgacagataactacgaaatccaaagtcgagcaact
tcctcttgggaacatggcaatccgattcataaggggactcagggaatttttcaagagtat
gagattccttatgacaagaacaagacatcgcttcagattagtaaggaagattttgaagcc
tttgattatattatcggaatggacgcttcaaatatttctgacttacgtcagatgtgtcca
gtagactgtcaagataagatttactcattttcatctgaaagtgttccagacccttggtat
acaggagattttgaagaaacctatcgacgtgttcaagagggctgtcaagcttggttagaa
cgtttagaaaaggagagttaa

DBGET integrated database retrieval system