KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10024
Entry
HMPREF0837_10024  CDS       T01259                                 

Gene name
yajC
Definition
(GenBank) preprotein translocase, YajC subunit
  KO
K03210  preprotein translocase subunit YajC
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc02024  Quorum sensing
snc03060  Protein export
snc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:snc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    HMPREF0837_10024 (yajC)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    HMPREF0837_10024 (yajC)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    HMPREF0837_10024 (yajC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:snc02044]
    HMPREF0837_10024 (yajC)
Secretion system [BR:snc02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   HMPREF0837_10024 (yajC)
SSDB
Motif
Pfam: YajC FLgD_tudor
Other DBs
NCBI-ProteinID: ADI68252
UniProt: D6ZMT1
Position
complement(20964..21263)
AA seq 99 aa
MNPNITFLIMLVGMMALMFFMQRSQKKQAQKRMESLNKLQKGYEVITIGGLYGTVDEVDT
EKGTIVLDVDGVYLTFELAAIKTVLPLKETASLEGAIEK
NT seq 300 nt   +upstreamnt  +downstreamnt
atgaatccaaatattacttttttaatcatgcttgtaggtatgatggccttgatgttcttt
atgcaacgttctcaaaagaaacaagctcaaaagcgtatggaaagcttaaataaactacaa
aaaggctatgaagtgattacaatcggtggactttatggaacagtcgatgaagtagatacg
gagaagggaacaatagttcttgacgtagatggagtttacttgacttttgaactagctgct
atcaagacagtattaccgctgaaagaaacagcttcactagaaggcgcaattgaaaaataa

DBGET integrated database retrieval system