KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10025
Entry
HMPREF0837_10025  CDS       T01259                                 

Gene name
tkt
Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc00030  Pentose phosphate pathway
snc01100  Metabolic pathways
snc01110  Biosynthesis of secondary metabolites
snc01120  Microbial metabolism in diverse environments
snc01200  Carbon metabolism
snc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:snc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HMPREF0837_10025 (tkt)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    HMPREF0837_10025 (tkt)
Enzymes [BR:snc01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     HMPREF0837_10025 (tkt)
SSDB
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C TPP_enzyme_C E1_dh DXP_synthase_N
Other DBs
NCBI-ProteinID: ADI68253
UniProt: D6ZN62
Position
complement(21380..23356)
AA seq 658 aa
MSNLSVNAIRFLGIDAINKANSGHPGVVMGAAPMAYSLFTKQLHINPAQPNWINRDRFIL
SAGHGSMLLYALLHLSGFEDVSMDEIKSFRQWGSKTPGHPEFGHTAGIDATTGPLGQGIS
TATGFAQAERFLAAKYNREGYNIFDHYTYVICGDGDLMEGVSSEAASYAGLQKLDKLVVL
YDSNDINLDGETKDSFTESVRDRYNAYGWHTALVENGTDLEAIHAAIETAKASGKPSLIE
VKTVIGYGSPNKQGTNAVHGAPLGADETASTRQALGWDYEPFEIPEQVYADFKEHVADRG
ASAYQAWTKLVADYKEAHPELAAEVEAIIDGRDPVEVTPADFPALENGFSQATRNSSQDA
LNVVAAKLPTFLGGSADLAHSNMTYIKTDGLQDDTNRLNRNIQFGVREFAMGTILNGMAL
HGGLRVYGGTFFVFSDYVKAAVRLSALQGLPVTYVFTHDSIAVGEDGPTHEPVEHLAGLR
AMPNLNVFRPADARETQAAWYLAVTSEKTPTALVLTRQNLTVEDGTDFDKVAKGAYVVYE
NAADFDTILIATGSEVNLAVSAAKELASQGEKIRVVSMPSTDVFDKQDAAYKEEILPNAV
RRRVAVEMGASQNWYKYVGLDGAVLGIDTFGASAPAPKVLAEYGFTVENLVKVVRNLK
NT seq 1977 nt   +upstreamnt  +downstreamnt
atgtcaaatctatctgttaatgcaattcgttttctaggtattgacgccattaataaagcc
aactcaggtcatccaggtgtggttatgggagcggctccgatggcttacagcctctttaca
aaacaacttcatatcaatccagctcaaccaaattggattaaccgcgaccgctttattctt
tcagcaggtcatggttcaatgctcctttatgctcttcttcacctttctggttttgaagat
gtcagcatggatgagattaagagcttccgtcaatggggttcaaaaacaccaggtcaccca
gaatttggtcatacggcagggattgatgctacgacaggtcctctagggcaagggatttca
actgctactggttttgcccaagcagaacgtttcttggcagccaaatataaccgtgaaggc
tacaatatctttgaccactatacttacgttatctgtggagacggagacttgatggaaggt
gtctcaagcgaggcagcttcatacgcaggtttgcaaaaacttgataagttggttgttctt
tatgattcaaatgatatcaacttggatggtgagacaaaggattcctttacagaaagtgtt
cgtgaccgttacaatgcctacggttggcatactgccttggttgaaaatggaacagacttg
gaagccatccatgctgctatcgaaacagcaaaagcttcaggcaagccatctttgattgaa
gtgaagacggttattggatatggttctccaaacaaacaaggaactaatgctgtacacggc
gcccctcttggagcagatgaaactgcatcaactcgccaagccctcggttgggactacgaa
ccatttgaaattccagaacaagtatatgctgatttcaaagaacatgttgcagaccgtggc
gcatcagcttatcaagcttggactaaattagttgcagattataaagaagctcatccagaa
ctggctgcagaagtagaagccatcatcgacggacgtgatccagtcgaagtgactccagca
gacttcccagctttagaaaatggtttttctcaagcaactcgtaattcaagtcaagatgcc
ttgaatgttgtggcagctaaattaccaaccttcctaggtggatcagctgaccttgctcac
tcaaacatgacttatatcaagacggatggacttcaagacgataccaatcgcttgaatcgt
aacattcagtttggtgttcgtgaatttgcaatgggaacaatcttgaacgggatggccctt
catggtggacttcgtgtatacggtggaactttcttcgtcttctctgactatgtgaaggca
gctgtccgcttgtcagccttacaaggacttcctgtgacttatgtctttacccatgattca
atcgcagttggggaagatggtccgactcacgaaccagttgagcatttagcaggtcttcgt
gctatgccaaatctaaatgttttccgtccagcagatgcgcgtgaaacgcaagcagcttgg
taccttgcagtgacaagtgagaaaacaccaactgcccttgtcttgacacgtcaaaacttg
actgttgaagatggaacagacttcgacaaggttgctaaaggtgcttatgttgtatatgaa
aatgcagccgactttgataccatcttgattgcgacaggttcagaggttaatcttgctgtc
tcagctgctaaagaattggctagtcaaggcgaaaaaatccgcgtagtcagcatgccatct
acagatgtctttgataaacaagatgcagcttacaaggaagaaattcttccaaatgcagtc
cgccgtcgtgttgcagtcgaaatgggtgcaagtcaaaactggtacaaatatgttggtctc
gatggtgccgttctaggtattgataccttcggagcctctgccccagcaccaaaagtattg
gcagaatatggctttactgtcgaaaatcttgtaaaagttgttcgaaatttgaaataa

DBGET integrated database retrieval system