KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10026
Entry
HMPREF0837_10026  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
  KO
K03476  L-ascorbate 6-phosphate lactonase [EC:3.1.1.-]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc00053  Ascorbate and aldarate metabolism
snc01100  Metabolic pathways
snc01120  Microbial metabolism in diverse environments
Module
snc_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:snc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    HMPREF0837_10026
Enzymes [BR:snc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     HMPREF0837_10026
SSDB
Motif
Pfam: Lactamase_B_3 Lactamase_B_2
Other DBs
NCBI-ProteinID: ADI68254
UniProt: D6ZN63
Position
complement(23470..24561)
AA seq 363 aa
MPNVKEITRESWILATFPEWGTWLNEEIEEEVVPEGNFAMWWLGNCGTWIKTPAGANVVM
DLWSNRGKSTKKVKDMVRGHQMANMAGVRKLQPNLRVQPMVIDPFAINELDYYLVSHFHS
DHIDPYTAAAILNNPKLEHVKFIGPYHCGRIWEGWGVPKERIIVVKPGDTIELKDMKIHA
VESFDRTCLVTLPVNGADETGGELAGLAVTDEEMAQKAVNYIFETPGGTIYHGADSHFSN
YFAKHGKDFKIDVALNNYGENPVGIQDKMTSIDLLRMAENLRTKVIIPVHYDIWSNFMAS
TNEILELWKMRKDRLQYDFHPFIWEVGGKYTYPQDQHLVEYHHPRGFDDCFEQDSNIQFK
ALL
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgccaaacgtcaaagaaattacaagagagtcatggattttagccactttcccagagtgg
ggaacatggttgaacgaagaaatcgaagaagaagtcgtacctgaaggcaactttgccatg
tggtggctaggcaactgtggtacttggattaagacaccagctggtgctaacgttgtcatg
gacctttggtcaaaccgtggaaaatcaaccaaaaaagtgaaagatatggttcgtgggcac
caaatggcaaatatggcaggtgttcgtaagttgcaaccaaacttgcgtgttcagccaatg
gttatcgatccatttgctatcaacgaactagactattacttagtttcacacttccacagt
gatcatatcgacccatacacagctgcagcaattctcaacaatcctaagttagagcatgtt
aagtttatcggtccttaccactgtggacgaatctgggaaggatggggggttccaaaagaa
cgtatcatcgttgttaaaccaggtgacactatcgaattaaaagatatgaagattcatgca
gtagaatcatttgaccgtacttgcttggtaactctcccagtgaacggtgctgatgagaca
ggcggtgaacttgctggcttggctgttacagatgaagaaatggctcaaaaggctgttaac
tatatctttgaaacaccaggtggaaccatctatcatggtgcagattctcacttctcaaac
tattttgcaaaacatggtaaagactttaaaattgatgttgctttgaataactatggtgaa
aatccggtaggtatccaagacaaaatgacatctatcgaccttcttcgtatggcagaaaat
ctgcgtaccaaagtcattatcccagttcactatgatatctggtctaacttcatggcttct
actaatgagattctagaactttggaaaatgcgaaaagatcgcttgcaatacgatttccat
ccatttatctgggaagttggcggtaagtacacttatcctcaagatcaacacttagtagaa
taccatcatccacgtggttttgatgattgttttgaacaagactctaacattcaatttaaa
gctttgctataa

DBGET integrated database retrieval system