KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10027
Entry
HMPREF0837_10027  CDS       T01259                                 

Definition
(GenBank) PRD domain protein
  KO
K03493  transcriptional antiterminator
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:snc03000]
    HMPREF0837_10027
Transcription factors [BR:snc03000]
 Prokaryotic type
  Other transcription factors
   BglG family
    HMPREF0837_10027
SSDB
Motif
Pfam: PRD HTH_11 PTS_IIB HTH_DeoR BTRD1
Other DBs
NCBI-ProteinID: ADI68255
UniProt: D6ZN64
Position
complement(24673..26304)
AA seq 543 aa
MDQETSKTIMAISKDLKESRRKIYYHIDKINAALGDEALHIISIPRIGIHLTEEQRDACC
KLLSEVDSYDYIMSAHERMMIMLLWIGISKERITIEKLIELTEVSRNTVLNDLNSIRYQL
TLEQYQVTLQVSKSQGYHLHAHPLNKIQYLQSLLYHIFMEENATFVSILEDKMKERLDDE
CLLSVEMNQFFKEQVPLVEQDLGKKINHHEITFMLQVLPYLLLSCHNVEQYQERHQDIEK
EFSLIRKRIEYQVSKKLGERLFQKFEISLSGLEVSLVAVLLLSYRKDLDIHAESDDFRQL
KLALEEFIWYFESQIRMEIENKDDLLRNLMIHCKALLFRKTYGIFSKNPLTKQIRSKYGE
LFLVTRKSAEILEGAWFIRLTDDDIAYLTIHIGGFLKYTPSSQKNMKKVYLVCDEGVAVS
RLLLKQCKLYFPNEQIDTVFTTEQFKSVEDIAQVDVVITTNDDLDSRFPILRVNPILEAE
DILKMLDYLKHNIFRNKSKSFSENLSSLISSYIVDSKLASKFQEEVQTLINQEIVVQAFL
EDI
NT seq 1632 nt   +upstreamnt  +downstreamnt
atggatcaagaaacgtccaaaacgattatggcgatttcgaaagatttgaaagagtcaaga
aggaaaatttattatcacattgacaaaatcaatgctgctctgggtgacgaggcgcttcac
atcattagtattccacgaattggtattcacttaacggaagagcagagagatgcttgttgt
aaactattatcggaagtagattcgtacgattatatcatgagtgcgcatgaacgtatgatg
ataatgttattatggataggtatttctaaagaacgtattacgattgaaaaattgatagag
ttaacagaggtatctaggaatactgttctcaatgatttgaatagtattcgttatcaacta
actttggaacaatatcaggtgaccttgcaagtgagcaagtcacagggataccaccttcat
gcccaccctcttaataaaattcagtatcttcaatcgcttctatatcatatttttatggaa
gaaaatgccacttttgtatctattttagaagataagatgaaagagaggttagatgatgag
tgtttgctttctgttgaaatgaaccaattttttaaggaacaggttcctttagttgaacaa
gatttagggaagaaaataaaccatcatgaaataacttttatgttgcaggttctaccttat
ttgctgttaagctgtcataatgttgaacagtatcaagaaagacatcaggatatagagaaa
gaattttctttgataagaaaaagaatagagtatcaggtgtctaagaaattaggagaacgg
ttgtttcaaaagtttgaaatttctttgtcaggacttgaagtttctcttgtagctgttctc
ctcctctcctatcgtaaagatttggatattcatgcagaaagtgatgattttcggcaatta
aaacttgctttagaagaatttatctggtattttgaatcacaaatccgaatggagattgag
aacaaggatgatttgttacgaaatttgatgatccactgtaaagccttgttatttagaaag
acttacggtattttttctaaaaatcctctaacaaaacaaattcgatccaagtatggagaa
ttatttttagtcactagaaaatctgcggaaattttagaaggagcatggtttattcggcta
acagacgatgatattgcctatttgacgattcatattggaggatttttaaaatatacacca
tcgtctcaaaaaaatatgaaaaaagtttatctcgtttgtgatgaaggtgttgcggtttcg
agacttttgctgaaacaatgcaaactttattttccaaatgagcaaattgacactgtattt
acaacagaacaatttaagagtgtggaagatattgcacaagttgatgtagtgattactact
aatgatgatttggatagcagatttccgattttaagggttaatcctatccttgaagcagaa
gatattttgaaaatgctagactatcttaaacacaatatatttcgtaataagagcaaaagt
ttcagtgaaaatctttctagtcttatttcgtcttatattgtagacagcaagttggctagt
aagttccaagaagaggttcaaacacttataaatcaagaaatagtagttcaagcttttttg
gaagatatttga

DBGET integrated database retrieval system