KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10028
Entry
HMPREF0837_10028  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Other DBs
NCBI-ProteinID: ADI68256
UniProt: D6ZN65
Position
complement(26304..26480)
AA seq 58 aa
MIFIESKVGVEVILKDFLEIALDIYIYGKIKRIAVISIDLGDFLIWYWIRQVVIYFNI
NT seq 177 nt   +upstreamnt  +downstreamnt
ttgatttttattgagagtaaagttggagttgaagtaattttgaaagattttttagaaata
gcgcttgatatatatatatatggtaaaataaaaagaattgctgtgatatcaatagatttg
ggggattttttaatatggtactggataaggcaagttgtgatttacttcaatatttga

DBGET integrated database retrieval system