KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10029
Entry
HMPREF0837_10029  CDS       T01259                                 

Definition
(GenBank) putative L-ribulose-5-phosphate 4-epimerase
  KO
K03077  L-ribulose-5-phosphate 4-epimerase [EC:5.1.3.4]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc00040  Pentose and glucuronate interconversions
snc00053  Ascorbate and aldarate metabolism
snc01100  Metabolic pathways
snc01120  Microbial metabolism in diverse environments
Module
snc_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:snc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HMPREF0837_10029
   00053 Ascorbate and aldarate metabolism
    HMPREF0837_10029
Enzymes [BR:snc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.4  L-ribulose-5-phosphate 4-epimerase
     HMPREF0837_10029
SSDB
Motif
Pfam: Aldolase_II Glyco_transf_4
Other DBs
NCBI-ProteinID: ADI68257
UniProt: D6ZN66
Position
complement(26529..27233)
AA seq 234 aa
MNQVINAMRKRVCDANQSLPKHGLVKFTWGNVSEVNRELGVIVIKPSGVDYDELTPENMV
VTDLDGKILEGDLRPSSDLPTHVQLYKAWSEIGSVVHTHSTEAVGWAQAGRDIPFYGTTH
ADYFYGSIPCARSLTKDEVEVAYEKDTGLVIVEEFEHRGLNPVEVPGIVVRNHGPFTWGK
NPENAVYHSVVLEEVSKMNRFTEQINPRVGPAPQYILEKHYQRKHGPNAYYGQK
NT seq 705 nt   +upstreamnt  +downstreamnt
atgaatcaagtaatcaatgctatgcgtaaacgagtctgtgatgccaatcaatcattgcca
aaacatggacttgtcaaatttacctgggggaatgtatctgaagtcaatcgcgaactcggt
gtcattgttatcaaaccatcaggcgtggattatgacgaattgacacctgaaaacatggta
gtgactgatctagatggtaagatcctagaaggggatttaagaccatcttccgacctccca
actcatgtgcaattatataaggcttggtcagaaattggtagtgtggttcacacccattcg
acagaagctgttggttgggctcaggcaggtcgtgatattcctttctacggaacaacccat
gcagattatttctacggttcaatcccttgcgcccgtagtttgaccaaggacgaagtagaa
gtggcctatgaaaaagatactggcctggttatcgtagaagaatttgaacatcgcggactt
aacccggttgaagtaccaggaattgttgtacgcaatcacggtccattcacctggggcaaa
aatccagagaatgctgtttatcactctgtcgtactagaggaagtatcaaagatgaatcgc
tttacagaacaaatcaatccaagagttggacctgctccccagtacatactagaaaaacac
taccaacgtaaacatggaccaaatgcttattatggtcaaaagtaa

DBGET integrated database retrieval system