KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10030
Entry
HMPREF0837_10030  CDS       T01259                                 

Definition
(GenBank) putative hexulose-6-phosphate isomerase
  KO
K03079  L-ribulose-5-phosphate 3-epimerase [EC:5.1.3.22]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc00040  Pentose and glucuronate interconversions
snc00053  Ascorbate and aldarate metabolism
snc01100  Metabolic pathways
snc01120  Microbial metabolism in diverse environments
Module
snc_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:snc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HMPREF0837_10030
   00053 Ascorbate and aldarate metabolism
    HMPREF0837_10030
Enzymes [BR:snc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.22  L-ribulose-5-phosphate 3-epimerase
     HMPREF0837_10030
SSDB
Motif
Pfam: AP_endonuc_2
Other DBs
NCBI-ProteinID: ADI68258
UniProt: D6ZN67
Position
complement(27235..28098)
AA seq 287 aa
MVRPIGIYEKATPTHFTWLERLNFAKELGFDFVEMSIDERDERLARLDWSKEERLEVVKA
IYGTGVRIPSICFSGHRRYPLGSKDPVLEEKSLELMKKCIELAQDLGVRTIQLAGYDVYY
EEKSPQTRQRFIKNLRKACDWAEEAQVVLAIEIMDDPFINSIEKYLAIEKEIDSPFLFVY
PDIGNVSAWHNDIYSEFYLGHHAIAALHLKDTYAVTESSRGQFRDVPFGQGCVKWEEAFD
ILKETNYNGPFLIEMWSENCETVEETRAAIQEAQAFLYPLIKKAGLM
NT seq 864 nt   +upstreamnt  +downstreamnt
atggtacgtccaattggaatttatgaaaaggcaaccccaacacactttacttggctagaa
cgtttaaattttgccaaggagttaggctttgattttgtcgagatgtctattgacgaacgt
gacgagcgtttagcaagacttgactggagtaaggaagaacgcttggaagttgtcaaagca
atctatggaactggtgttcgtattccttctatctgtttttcaggccatcgtcgctaccca
ttgggttcaaaagatccagttctagaggaaaaatctctagaactcatgaaaaaatgtatc
gaattagctcaagacttgggagttcgtacgattcaattagctggttacgatgtttactat
gaggaaaagtcaccccagacacgccaacgttttatcaaaaatttgagaaaagcctgtgac
tgggctgaagaagctcaggtggtacttgctattgaaattatggatgatcctttcatcaat
agcatcgaaaaatatttggctatagaaaaagagattgactctcccttcctctttgtatat
ccagatattggtaatgtgtctgcatggcataatgatatctatagtgagttttatcttggt
catcatgccatcgcagctctccatctcaaggatacttatgcagtgacagaaagttcaagg
ggccagttccgagatgtaccttttgggcaaggttgtgtcaaatgggaagaagctttcgat
attttaaaggaaaccaattataatggacctttcctaatcgaaatgtggtctgaaaattgt
gaaacagtagaagaaacacgcgcagccattcaagaggcgcaagcttttctctatccactc
attaagaaagcaggtttgatgtaa

DBGET integrated database retrieval system