KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10031
Entry
HMPREF0837_10031  CDS       T01259                                 

Gene name
pyrF
Definition
(GenBank) orotidine 5'-phosphate decarboxylase/HUMPS family
  KO
K03078  3-dehydro-L-gulonate-6-phosphate decarboxylase [EC:4.1.1.85]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc00040  Pentose and glucuronate interconversions
snc00053  Ascorbate and aldarate metabolism
snc01100  Metabolic pathways
snc01120  Microbial metabolism in diverse environments
Module
snc_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:snc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HMPREF0837_10031 (pyrF)
   00053 Ascorbate and aldarate metabolism
    HMPREF0837_10031 (pyrF)
Enzymes [BR:snc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.85  3-dehydro-L-gulonate-6-phosphate decarboxylase
     HMPREF0837_10031 (pyrF)
SSDB
Motif
Pfam: OMPdecase
Other DBs
NCBI-ProteinID: ADI68259
UniProt: D6ZN68
Position
complement(28102..28767)
AA seq 221 aa
MTKRIPNLQVALDHSDLQGAIKAAVSVGQEVDIIEAGTVCLLQVGSELAEVLRSLFPDKI
IVADTKCADAGGTVAKNNAVRGADWMTCICCATIPTMEAALKAIKTERGERGEIQIELYG
DWTFEQAQLWLDAGISQAIYHQSRDALLAGETWGEKDLNKVKKLIDMGFRVSVTGGLDVD
TLKLFEGVDVFTFIAGRGITEAADPAGAARAFKDEIKRIWG
NT seq 666 nt   +upstreamnt  +downstreamnt
atgacaaaaagaatacctaatttacaagttgcattagaccattcagacttgcaaggagcg
attaaagcagctgtttctgttggtcaggaagtagatattatcgaagctggaactgtttgc
ttgcttcaagttggaagtgaactggctgaagtcttgcgtagccttttcccagataagatt
attgtggcagacacaaaatgtgctgatgctggtggaacagttgctaaaaataatgcggtt
cgtggagcagactggatgacttgtatctgttgtgcaaccatccctactatggaagcagct
ctaaaggctatcaagactgaacgaggagaacgaggcgaaatccagatcgagctttatggc
gattggacttttgaacaagctcagctttggctagatgcaggtatctcacaagctatttat
caccaatctcgtgatgctcttcttgctggtgaaacttggggtgaaaaagaccttaataag
gttaaaaaactcattgacatgggcttccgtgtatctgtaacaggtggtctagatgtagat
actctcaaactctttgaaggtgttgatgtctttacctttatcgcaggtcgtggaattaca
gaggctgcggatccagcaggagcagcgcgtgccttcaaggatgaaatcaaacgaatttgg
gggtaa

DBGET integrated database retrieval system