KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10032
Entry
HMPREF0837_10032  CDS       T01259                                 

Definition
(GenBank) phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2
  KO
K02821  ascorbate PTS system EIIA or EIIAB component [EC:2.7.1.194]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc00053  Ascorbate and aldarate metabolism
snc01100  Metabolic pathways
snc01120  Microbial metabolism in diverse environments
snc02060  Phosphotransferase system (PTS)
Module
snc_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:snc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    HMPREF0837_10032
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    HMPREF0837_10032
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:snc02000]
    HMPREF0837_10032
Enzymes [BR:snc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.194  protein-Npi-phosphohistidine---L-ascorbate phosphotransferase
     HMPREF0837_10032
Transporters [BR:snc02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Ascorbate-specific II component
    HMPREF0837_10032
SSDB
Motif
Pfam: PTS_EIIA_2
Other DBs
NCBI-ProteinID: ADI68260
UniProt: D6ZN69
Position
complement(28784..29269)
AA seq 161 aa
MNLKQALIDNDSIRLGLEANNWKEAVKVAVDPLIESGAILPEYYDAIIESTEEYGPYYIL
MPGMAMPHARPEAGVQSDAFSLITLQNPVVFSDGKEVSVLLALAATSSKIHTSVAIPQII
ALFELEDSIARLQACQTKEDVLAMIEESKDSPYLEGLDLES
NT seq 486 nt   +upstreamnt  +downstreamnt
atgaatttaaaacaagctttaattgacaatgactcgatccgactaggtttagaggctaac
aattggaaagaagcagtcaaggtagcagtagatcccttaattgaaagtggggcaattttg
ccagagtattacgatgctatcattgaatcgactgaagagtatgggccttactatatcttg
atgccaggtatggctatgccccacgctagacctgaagctggtgtgcaaagtgatgccttt
tcattgattaccttacaaaatcctgttgtattttcagatgggaaagaggtatctgttttg
ttggcactagcagcaacaagctcaaaaattcacacaagtgtagccattccacaaattatt
gccctgtttgaattagaagattctattgcacgtttacaggcttgccagactaaagaagat
gtcttggctatgattgaagaatctaaggatagcccttatctcgaaggattggatttggaa
agttag

DBGET integrated database retrieval system